eF-site ID 2q7a-AB PDB Code 2q7a Chain A, B click to enlarge Title Crystal structure of the cell surface heme transfer protein Shp Classification heme binding protein Compound Cell surface heme-binding protein Source Streptococcus pyogenes (Q06A48_STRPY) Sequence A:  MDKGQIYGSIIQRNYRHPISGQIEDSGGEHSFDIGQGMVE GTVYSDAMLEVSDAGKIVLTFRMSLADYSGNYQFWIQPGG TGSFQAVDYNITQKGTDTNGTTLDIAISLPTVNSIIRGSM FVEPMGREVVFYLSASELIQKYSGNMLAQLVT B:  MDKGQIYGSIIQRNYRHPISGQIEDSGGEHSFDIGQGMVE GTVYSDAMLEVSDAGKIVLTFRMSLADYSGNYQFWIQPGG TGSFQAVDYNITQKGTDTNGTTLDIAISLPTVNSIIRGSM FVEPMGREVVFYLSASELIQKYSGNMLAQLVT Description Functional site 1) chain A residue 65 type sequence G description BINDING SITE FOR RESIDUE HEM A 182 source : AC1 2) chain A residue 127 type sequence N description BINDING SITE FOR RESIDUE HEM A 182 source : AC1 3) chain B residue 62 type sequence I description BINDING SITE FOR RESIDUE HEM A 182 source : AC1 4) chain B residue 65 type sequence G description BINDING SITE FOR RESIDUE HEM A 182 source : AC1 5) chain B residue 66 type sequence M description BINDING SITE FOR RESIDUE HEM A 182 source : AC1 6) chain A residue 43 type sequence Y description BINDING SITE FOR RESIDUE HEM A 184 source : AC2 7) chain A residue 62 type sequence I description BINDING SITE FOR RESIDUE HEM A 184 source : AC2 8) chain A residue 66 type sequence M description BINDING SITE FOR RESIDUE HEM A 184 source : AC2 9) chain A residue 67 type sequence V description BINDING SITE FOR RESIDUE HEM A 184 source : AC2 10) chain A residue 70 type sequence T description BINDING SITE FOR RESIDUE HEM A 184 source : AC2 11) chain A residue 93 type sequence L description BINDING SITE FOR RESIDUE HEM A 184 source : AC2 12) chain A residue 96 type sequence Y description BINDING SITE FOR RESIDUE HEM A 184 source : AC2 13) chain A residue 150 type sequence V description BINDING SITE FOR RESIDUE HEM A 184 source : AC2 14) chain A residue 153 type sequence M description BINDING SITE FOR RESIDUE HEM A 184 source : AC2 15) chain A residue 155 type sequence R description BINDING SITE FOR RESIDUE HEM A 184 source : AC2 16) chain A residue 157 type sequence V description BINDING SITE FOR RESIDUE HEM A 184 source : AC2 17) chain B residue 43 type sequence Y description BINDING SITE FOR RESIDUE HEM B 181 source : AC3 18) chain B residue 62 type sequence I description BINDING SITE FOR RESIDUE HEM B 181 source : AC3 19) chain B residue 63 type sequence G description BINDING SITE FOR RESIDUE HEM B 181 source : AC3 20) chain B residue 66 type sequence M description BINDING SITE FOR RESIDUE HEM B 181 source : AC3 21) chain B residue 67 type sequence V description BINDING SITE FOR RESIDUE HEM B 181 source : AC3 22) chain B residue 70 type sequence T description BINDING SITE FOR RESIDUE HEM B 181 source : AC3 23) chain B residue 93 type sequence L description BINDING SITE FOR RESIDUE HEM B 181 source : AC3 24) chain B residue 97 type sequence S description BINDING SITE FOR RESIDUE HEM B 181 source : AC3 25) chain B residue 150 type sequence V description BINDING SITE FOR RESIDUE HEM B 181 source : AC3 26) chain B residue 153 type sequence M description BINDING SITE FOR RESIDUE HEM B 181 source : AC3 27) chain B residue 155 type sequence R description BINDING SITE FOR RESIDUE HEM B 181 source : AC3 28) chain B residue 158 type sequence V description BINDING SITE FOR RESIDUE HEM B 181 source : AC3 29) chain A residue 65 type sequence G description BINDING SITE FOR RESIDUE HEM B 183 source : AC4 30) chain A residue 66 type sequence M description BINDING SITE FOR RESIDUE HEM B 183 source : AC4 31) chain B residue 65 type sequence G description BINDING SITE FOR RESIDUE HEM B 183 source : AC4 32) chain B residue 68 type sequence E description BINDING SITE FOR RESIDUE HEM B 183 source : AC4 33) chain B residue 127 type sequence N description BINDING SITE FOR RESIDUE HEM B 183 source : AC4 34) chain A residue 97 type sequence S description BINDING SITE FOR RESIDUE GOL A 1188 source : AC5 35) chain A residue 98 type sequence G description BINDING SITE FOR RESIDUE GOL A 1188 source : AC5 36) chain A residue 99 type sequence N description BINDING SITE FOR RESIDUE GOL A 1188 source : AC5 37) chain A residue 100 type sequence Y description BINDING SITE FOR RESIDUE GOL A 1188 source : AC5 38) chain A residue 99 type sequence N description BINDING SITE FOR RESIDUE GOL A 1189 source : AC6 39) chain A residue 122 type sequence K description BINDING SITE FOR RESIDUE GOL A 1189 source : AC6 40) chain A residue 123 type sequence G description BINDING SITE FOR RESIDUE GOL A 1189 source : AC6 41) chain A residue 124 type sequence T description BINDING SITE FOR RESIDUE GOL A 1189 source : AC6 42) chain A residue 57 type sequence E description BINDING SITE FOR RESIDUE GOL A 1190 source : AC7 43) chain A residue 58 type sequence H description BINDING SITE FOR RESIDUE GOL A 1190 source : AC7 44) chain A residue 41 type sequence R description BINDING SITE FOR RESIDUE GOL A 1193 source : AC8 45) chain A residue 68 type sequence E description BINDING SITE FOR RESIDUE GOL A 1193 source : AC8 46) chain A residue 69 type sequence G description BINDING SITE FOR RESIDUE GOL A 1193 source : AC8 47) chain A residue 71 type sequence V description BINDING SITE FOR RESIDUE GOL A 1193 source : AC8 48) chain A residue 72 type sequence Y description BINDING SITE FOR RESIDUE GOL A 1193 source : AC8 49) chain A residue 96 type sequence Y description BINDING SITE FOR RESIDUE GOL B 1185 source : AC9 50) chain B residue 96 type sequence Y description BINDING SITE FOR RESIDUE GOL B 1185 source : AC9 51) chain B residue 127 type sequence N description BINDING SITE FOR RESIDUE GOL B 1185 source : AC9 52) chain B residue 97 type sequence S description BINDING SITE FOR RESIDUE GOL B 1186 source : BC1 53) chain B residue 98 type sequence G description BINDING SITE FOR RESIDUE GOL B 1186 source : BC1 54) chain B residue 99 type sequence N description BINDING SITE FOR RESIDUE GOL B 1186 source : BC1 55) chain B residue 100 type sequence Y description BINDING SITE FOR RESIDUE GOL B 1186 source : BC1 56) chain B residue 99 type sequence N description BINDING SITE FOR RESIDUE GOL B 1187 source : BC2 57) chain B residue 101 type sequence Q description BINDING SITE FOR RESIDUE GOL B 1187 source : BC2 58) chain B residue 123 type sequence G description BINDING SITE FOR RESIDUE GOL B 1187 source : BC2 59) chain B residue 124 type sequence T description BINDING SITE FOR RESIDUE GOL B 1187 source : BC2 60) chain B residue 56 type sequence G description BINDING SITE FOR RESIDUE GOL B 1191 source : BC3 61) chain B residue 57 type sequence E description BINDING SITE FOR RESIDUE GOL B 1191 source : BC3 62) chain B residue 58 type sequence H description BINDING SITE FOR RESIDUE GOL B 1191 source : BC3 63) chain B residue 171 type sequence S description BINDING SITE FOR RESIDUE GOL B 1191 source : BC3 64) chain A residue 139 type sequence T description BINDING SITE FOR RESIDUE GOL B 1192 source : BC4 65) chain A residue 141 type sequence N description BINDING SITE FOR RESIDUE GOL B 1192 source : BC4 66) chain B residue 169 type sequence K description BINDING SITE FOR RESIDUE GOL B 1192 source : BC4

Display surface Download Links