eF-site ID 2q1z_1-B PDB Code 2q1z Model 1 Chain B click to enlarge Title Crystal Structure of Rhodobacter sphaeroides SigE in complex with the anti-sigma ChrR Classification TRANSCRIPTION Compound RpoE, ECF SigE Source null (CHRR_RHOS4) Sequence B:  TIRHHVSDALLTAYAAGTLSEAFSLVVATHLSLCDECRAR AGALDAVGGSLMEETAPVALSEGSLASVMAQLDRQIADPR APAPLADYVGRRLEDVRWRTLGGGVRQAILPTGGEAIARL LWIPGGQAVPDHGHRGLELTLVLQGAFRDETDRFGAGDIE IADQELEHTPVAERGLDCICLAATD Description Functional site 1) chain B residue 6 type sequence H description BINDING SITE FOR RESIDUE ZN B 196 source : AC1 2) chain B residue 31 type sequence H description BINDING SITE FOR RESIDUE ZN B 196 source : AC1 3) chain B residue 35 type sequence C description BINDING SITE FOR RESIDUE ZN B 196 source : AC1 4) chain B residue 38 type sequence C description BINDING SITE FOR RESIDUE ZN B 196 source : AC1 5) chain B residue 141 type sequence H description BINDING SITE FOR RESIDUE ZN B 197 source : AC2 6) chain B residue 143 type sequence H description BINDING SITE FOR RESIDUE ZN B 197 source : AC2 7) chain B residue 147 type sequence E description BINDING SITE FOR RESIDUE ZN B 197 source : AC2 8) chain B residue 177 type sequence H description BINDING SITE FOR RESIDUE ZN B 197 source : AC2 9) chain B residue 6 type BINDING sequence H description source Swiss-Prot : SWS_FT_FI1 10) chain B residue 31 type BINDING sequence H description source Swiss-Prot : SWS_FT_FI1 11) chain B residue 35 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI1 12) chain B residue 38 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI1 13) chain B residue 141 type BINDING sequence H description source Swiss-Prot : SWS_FT_FI1 14) chain B residue 143 type BINDING sequence H description source Swiss-Prot : SWS_FT_FI1 15) chain B residue 147 type BINDING sequence E description source Swiss-Prot : SWS_FT_FI1 16) chain B residue 177 type BINDING sequence H description source Swiss-Prot : SWS_FT_FI1

Display surface Download Links