eF-site ID 2q1z_1-ABCD PDB Code 2q1z Model 1 Chain A, B, C, D click to enlarge Title Crystal Structure of Rhodobacter sphaeroides SigE in complex with the anti-sigma ChrR Classification TRANSCRIPTION Compound RpoE, ECF SigE Source Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) (CHRR_RHOS4) Sequence A:  SDRTDWVALMRAIRDHRDEAAFAELFQHFAPKVKGFLMKS GSVASQAEECAQDVMATVWQKAHLFDPSRASVATWIFTIA RNRRIDGLRKDRQPEPEDLFWGPDSEPDQADVYEMQQENA RLGRAIARLPEAQRALIERAFFGDLTHRELAAETGLPLGT IKSRIRLALDRLRQHM B:  TIRHHVSDALLTAYAAGTLSEAFSLVVATHLSLCDECRAR AGALDAVGGSLMEETAPVALSEGSLASVMAQLDRQIADPR APAPLADYVGRRLEDVRWRTLGGGVRQAILPTGGEAIARL LWIPGGQAVPDHGHRGLELTLVLQGAFRDETDRFGAGDIE IADQELEHTPVAERGLDCICLAATD C:  SDRTDWVALMRAIRDHRDEAAFAELFQHFAPKVKGFLMKS GSVASQAEECAQDVMATVWQKAHLFDPSRASVATWIFTIA RNRRIDGLRKDRQPEPEDLFWGPDSEPDQADVYEMQQENA RLGRAIAALIERAFFGDLTHRELAAETGLPLGTIKSRIRL ALDR D:  TIRHHVSDALLTAYAAGTLSEAFSLVVATHLSLCDECRAR AGALDAVGGSLMEETAPVALSEGSLASVMAQLDDPRAPAP LADYVGRRLEDVRWRTLGGGVRQAILPTGGEAIARLLWIP GGQAVPDHGHRGLELTLVLQGAFRDETDRFGAGDIEIADQ ELEHTPVAERGLDCICLAATD Description Functional site 1) chain B residue 6 type sequence H description BINDING SITE FOR RESIDUE ZN B 196 source : AC1 2) chain B residue 31 type sequence H description BINDING SITE FOR RESIDUE ZN B 196 source : AC1 3) chain B residue 35 type sequence C description BINDING SITE FOR RESIDUE ZN B 196 source : AC1 4) chain B residue 38 type sequence C description BINDING SITE FOR RESIDUE ZN B 196 source : AC1 5) chain B residue 141 type sequence H description BINDING SITE FOR RESIDUE ZN B 197 source : AC2 6) chain B residue 143 type sequence H description BINDING SITE FOR RESIDUE ZN B 197 source : AC2 7) chain B residue 147 type sequence E description BINDING SITE FOR RESIDUE ZN B 197 source : AC2 8) chain B residue 177 type sequence H description BINDING SITE FOR RESIDUE ZN B 197 source : AC2 9) chain D residue 6 type sequence H description BINDING SITE FOR RESIDUE ZN D 196 source : AC3 10) chain D residue 31 type sequence H description BINDING SITE FOR RESIDUE ZN D 196 source : AC3 11) chain D residue 35 type sequence C description BINDING SITE FOR RESIDUE ZN D 196 source : AC3 12) chain D residue 38 type sequence C description BINDING SITE FOR RESIDUE ZN D 196 source : AC3 13) chain D residue 141 type sequence H description BINDING SITE FOR RESIDUE ZN D 197 source : AC4 14) chain D residue 143 type sequence H description BINDING SITE FOR RESIDUE ZN D 197 source : AC4 15) chain D residue 147 type sequence E description BINDING SITE FOR RESIDUE ZN D 197 source : AC4 16) chain D residue 177 type sequence H description BINDING SITE FOR RESIDUE ZN D 197 source : AC4 17) chain B residue 6 type BINDING sequence H description source Swiss-Prot : SWS_FT_FI1 18) chain D residue 31 type BINDING sequence H description source Swiss-Prot : SWS_FT_FI1 19) chain D residue 35 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI1 20) chain D residue 38 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI1 21) chain D residue 141 type BINDING sequence H description source Swiss-Prot : SWS_FT_FI1 22) chain D residue 143 type BINDING sequence H description source Swiss-Prot : SWS_FT_FI1 23) chain D residue 147 type BINDING sequence E description source Swiss-Prot : SWS_FT_FI1 24) chain D residue 177 type BINDING sequence H description source Swiss-Prot : SWS_FT_FI1 25) chain B residue 31 type BINDING sequence H description source Swiss-Prot : SWS_FT_FI1 26) chain B residue 35 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI1 27) chain B residue 38 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI1 28) chain B residue 141 type BINDING sequence H description source Swiss-Prot : SWS_FT_FI1 29) chain B residue 143 type BINDING sequence H description source Swiss-Prot : SWS_FT_FI1 30) chain B residue 147 type BINDING sequence E description source Swiss-Prot : SWS_FT_FI1 31) chain B residue 177 type BINDING sequence H description source Swiss-Prot : SWS_FT_FI1 32) chain D residue 6 type BINDING sequence H description source Swiss-Prot : SWS_FT_FI1

Display surface Download Links