eF-site ID 2q1z_1-D PDB Code 2q1z Model 1 Chain D click to enlarge Title Crystal Structure of Rhodobacter sphaeroides SigE in complex with the anti-sigma ChrR Classification TRANSCRIPTION Compound RpoE, ECF SigE Source Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) (CHRR_RHOS4) Sequence D:  TIRHHVSDALLTAYAAGTLSEAFSLVVATHLSLCDECRAR AGALDAVGGSLMEETAPVALSEGSLASVMAQLDDPRAPAP LADYVGRRLEDVRWRTLGGGVRQAILPTGGEAIARLLWIP GGQAVPDHGHRGLELTLVLQGAFRDETDRFGAGDIEIADQ ELEHTPVAERGLDCICLAATD Description Functional site 1) chain D residue 6 type sequence H description BINDING SITE FOR RESIDUE ZN D 196 source : AC3 2) chain D residue 31 type sequence H description BINDING SITE FOR RESIDUE ZN D 196 source : AC3 3) chain D residue 35 type sequence C description BINDING SITE FOR RESIDUE ZN D 196 source : AC3 4) chain D residue 38 type sequence C description BINDING SITE FOR RESIDUE ZN D 196 source : AC3 5) chain D residue 141 type sequence H description BINDING SITE FOR RESIDUE ZN D 197 source : AC4 6) chain D residue 143 type sequence H description BINDING SITE FOR RESIDUE ZN D 197 source : AC4 7) chain D residue 147 type sequence E description BINDING SITE FOR RESIDUE ZN D 197 source : AC4 8) chain D residue 177 type sequence H description BINDING SITE FOR RESIDUE ZN D 197 source : AC4 9) chain D residue 31 type BINDING sequence H description source Swiss-Prot : SWS_FT_FI1 10) chain D residue 35 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI1 11) chain D residue 38 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI1 12) chain D residue 141 type BINDING sequence H description source Swiss-Prot : SWS_FT_FI1 13) chain D residue 143 type BINDING sequence H description source Swiss-Prot : SWS_FT_FI1 14) chain D residue 147 type BINDING sequence E description source Swiss-Prot : SWS_FT_FI1 15) chain D residue 177 type BINDING sequence H description source Swiss-Prot : SWS_FT_FI1 16) chain D residue 6 type BINDING sequence H description source Swiss-Prot : SWS_FT_FI1

Display surface Download Links