eF-site ID 2pzy-A PDB Code 2pzy Chain A click to enlarge Title Structure of MK2 Complexed with Compound 76 Classification TRANSFERASE Compound MAP kinase-activated protein kinase 2 Source Homo sapiens (Human) (MAPK2_HUMAN) Sequence A:  QFPQFHVKSGLQIKKNAIIDDYKVTSQVLGLGINGKVLQI FNKRTQEKFALKMLQDCPKARREVELHWRASQCPHIVRIV DVYENLYAGRKCLLIVMECLDGGELFSRIQDRAFTEREAS EIMKSIGEAIQYLHSINIAHRDVKPENLLYTSKRPNAILK LTDFGFAKETTPYYVAPEVLGPEKYDKSCDMWSLGVIMYI LLCGYPPFYSNHGLAISPGMKTRIRMGQYEFPNPEWSEVS EEVKMLIRNLLKTEPTQRMTITEFMNHPWIMQSTKVPQTP LHTSRVLKEDK Description Functional site 1) chain A residue 186 type ACT_SITE sequence D description Proton acceptor source Swiss-Prot : SWS_FT_FI1 2) chain A residue 139 type BINDING sequence E description source Swiss-Prot : SWS_FT_FI3 3) chain A residue 272 type MOD_RES sequence S description Phosphoserine; by MAPK14 => ECO:0000269|PubMed:8846784 source Swiss-Prot : SWS_FT_FI5 4) chain A residue 328 type MOD_RES sequence S description Phosphoserine; by autocatalysis => ECO:0000250 source Swiss-Prot : SWS_FT_FI6 5) chain A residue 334 type MOD_RES sequence T description Phosphothreonine; by MAPK14 => ECO:0000269|PubMed:8846784, ECO:0007744|PubMed:23186163, ECO:0007744|PubMed:24275569 source Swiss-Prot : SWS_FT_FI7 6) chain A residue 70-93 type prosite sequence LGLGINGKVLQIFNKRTQEKFALK description PROTEIN_KINASE_ATP Protein kinases ATP-binding region signature. LGLGINGKVLqIfnkrtqek..........FALK source prosite : PS00107 7) chain A residue 182-194 type prosite sequence IAHRDVKPENLLY description PROTEIN_KINASE_ST Serine/Threonine protein kinases active-site signature. IaHrDVKpeNLLY source prosite : PS00108 8) chain A residue 93 type BINDING sequence K description BINDING => ECO:0000255|PROSITE-ProRule:PRU00159 source Swiss-Prot : SWS_FT_FI2 9) chain A residue 70 type BINDING sequence L description BINDING => ECO:0000255|PROSITE-ProRule:PRU00159 source Swiss-Prot : SWS_FT_FI2

Display surface Download Links