eF-site ID 2px7-AB PDB Code 2px7 Chain A, B click to enlarge Title Crystal structure of 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase from Thermus thermophilus HB8 Classification TRANSFERASE Compound 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Source null (ISPD_THET8) Sequence A:  MEVSVLIPAAGGPKAFLQVGGRTLLEWTLAAFRDAAEVLV ALPPGAEPPKGLGAVFLEGGATRQASVARLLEAASLPLVL VHDVARPFVSRGLVARVLEAAQRSGAAVPVLPVPDTLMAP EGEAYGRVVPREAFRLVQTPQGFFTALLREAHAYARRKGL EASDDAQLVQALGYPVALVEGEATAFKITHPQDLVLAEAL ARV B:  MEVSVLIPAAGPKAFLQVGGRTLLEWTLAAFRDAAEVLVA LPPGAEPPKGLGAVFLEGGATRQASVARLLEAASLPLVLV HDVARPFVSRGLVARVLEAAQRSGAAVPVLPVPDTLMAPE GEAYGRVVPREAFRLVQTPQGFFTALLREAHAYARRKGLE ASDDAQLVQALGYPVALVEGEATAFKITHPQDLVLAEALA RV Description Functional site 1) chain A residue 21 type SITE sequence K description Transition state stabilizer => ECO:0000255|HAMAP-Rule:MF_00108 source Swiss-Prot : SWS_FT_FI1 2) chain B residue 21 type SITE sequence K description Transition state stabilizer => ECO:0000255|HAMAP-Rule:MF_00108 source Swiss-Prot : SWS_FT_FI1 3) chain A residue 138 type SITE sequence R description Positions MEP for the nucleophilic attack => ECO:0000255|HAMAP-Rule:MF_00108 source Swiss-Prot : SWS_FT_FI2 4) chain A residue 194 type SITE sequence K description Positions MEP for the nucleophilic attack => ECO:0000255|HAMAP-Rule:MF_00108 source Swiss-Prot : SWS_FT_FI2 5) chain B residue 138 type SITE sequence R description Positions MEP for the nucleophilic attack => ECO:0000255|HAMAP-Rule:MF_00108 source Swiss-Prot : SWS_FT_FI2 6) chain B residue 194 type SITE sequence K description Positions MEP for the nucleophilic attack => ECO:0000255|HAMAP-Rule:MF_00108 source Swiss-Prot : SWS_FT_FI2 7) chain A residue 86-93 type prosite sequence VLVHDVAR description ISPD 4-diphosphocytidyl-2C-methyl-D-erythritol synthase signature. VLVHDVAR source prosite : PS01295

Display surface Download Links