eF-site ID 2pvo-D PDB Code 2pvo Chain D click to enlarge Title Crystal srtucture of the ternary complex between thioredoxin f, ferredoxin, and ferredoxin: thioredoxin reductase Classification ELECTRON TRANSPORT Compound Ferredoxin-thioredoxin reductase, catalytic chain Source Synechocystis sp. (strain PCC 6803 / Kazusa) (FER_SYNY3) Sequence D:  ASYTVKLITPDGESSIECSDDTYILDAAEEAGLELPYSCR AGACSTCAGKITAGSVDQSDQSFLDDDQIEAGYVLTCVAY PTSDCTIETHKEEDLY Description Functional site 1) chain D residue 34 type sequence E description BINDING SITE FOR RESIDUE SO4 A 202 source : AC2 2) chain D residue 36 type sequence P description BINDING SITE FOR RESIDUE SO4 A 202 source : AC2 3) chain D residue 37 type sequence Y description BINDING SITE FOR RESIDUE SO4 A 202 source : AC2 4) chain D residue 38 type sequence S description BINDING SITE FOR RESIDUE FES D 400 source : AC4 5) chain D residue 39 type sequence C description BINDING SITE FOR RESIDUE FES D 400 source : AC4 6) chain D residue 40 type sequence R description BINDING SITE FOR RESIDUE FES D 400 source : AC4 7) chain D residue 42 type sequence G description BINDING SITE FOR RESIDUE FES D 400 source : AC4 8) chain D residue 43 type sequence A description BINDING SITE FOR RESIDUE FES D 400 source : AC4 9) chain D residue 44 type sequence C description BINDING SITE FOR RESIDUE FES D 400 source : AC4 10) chain D residue 47 type sequence C description BINDING SITE FOR RESIDUE FES D 400 source : AC4 11) chain D residue 77 type sequence C description BINDING SITE FOR RESIDUE FES D 400 source : AC4 12) chain D residue 39-47 type prosite sequence CRAGACSTC description 2FE2S_FER_1 2Fe-2S ferredoxin-type iron-sulfur binding region signature. CRAGACSTC source prosite : PS00197 13) chain D residue 39 type BINDING sequence C description BINDING => ECO:0000255|PROSITE-ProRule:PRU00465, ECO:0000269|PubMed:7578051 source Swiss-Prot : SWS_FT_FI1 14) chain D residue 44 type BINDING sequence C description BINDING => ECO:0000255|PROSITE-ProRule:PRU00465, ECO:0000269|PubMed:7578051 source Swiss-Prot : SWS_FT_FI1 15) chain D residue 47 type BINDING sequence C description BINDING => ECO:0000255|PROSITE-ProRule:PRU00465, ECO:0000269|PubMed:7578051 source Swiss-Prot : SWS_FT_FI1 16) chain D residue 77 type BINDING sequence C description BINDING => ECO:0000255|PROSITE-ProRule:PRU00465, ECO:0000269|PubMed:7578051 source Swiss-Prot : SWS_FT_FI1

Display surface Download Links