eF-site ID 2pvo-ABCD PDB Code 2pvo Chain A, B, C, D click to enlarge Title Crystal srtucture of the ternary complex between thioredoxin f, ferredoxin, and ferredoxin: thioredoxin reductase Classification ELECTRON TRANSPORT Compound Ferredoxin-thioredoxin reductase, catalytic chain Source null (FER_SYNY3) Sequence A:  NKTLAAMKNFAEQYAKRTDTYFCSDLSVTAVVIEGLARHK EELGSPLCPCRHYEDKEAEVKNTFWNCPCVPMRERKECHC MLFLTPDNDFAGDAQDIPMETLEEVKASMA B:  MNVGDRVRVTSSVVVYHHPEHKKTAFDLQGMEGEVAAVLT EWQGRPISANLPVLVKFEQRFKAHFRPDEVTLIE C:  EAIVGKVTEVNKDTFWPIVKAAGDKPVVLDMFTQWCGPSK AMAPKYEKLAEEYLDVIFLKLDCNQENKTLAKELGIRVVP TFKILKENSVVGEVTGAKYDKLLEAIQAARS D:  ASYTVKLITPDGESSIECSDDTYILDAAEEAGLELPYSCR AGACSTCAGKITAGSVDQSDQSFLDDDQIEAGYVLTCVAY PTSDCTIETHKEEDLY Description Functional site 1) chain A residue 80 type sequence R description BINDING SITE FOR RESIDUE SO4 A 201 source : AC1 2) chain B residue 62 type sequence K description BINDING SITE FOR RESIDUE SO4 A 201 source : AC1 3) chain A residue 50 type sequence L description BINDING SITE FOR RESIDUE SO4 A 202 source : AC2 4) chain A residue 51 type sequence G description BINDING SITE FOR RESIDUE SO4 A 202 source : AC2 5) chain A residue 52 type sequence S description BINDING SITE FOR RESIDUE SO4 A 202 source : AC2 6) chain D residue 34 type sequence E description BINDING SITE FOR RESIDUE SO4 A 202 source : AC2 7) chain D residue 36 type sequence P description BINDING SITE FOR RESIDUE SO4 A 202 source : AC2 8) chain D residue 37 type sequence Y description BINDING SITE FOR RESIDUE SO4 A 202 source : AC2 9) chain A residue 55 type sequence C description BINDING SITE FOR RESIDUE SF4 A 300 source : AC3 10) chain A residue 74 type sequence C description BINDING SITE FOR RESIDUE SF4 A 300 source : AC3 11) chain A residue 76 type sequence C description BINDING SITE FOR RESIDUE SF4 A 300 source : AC3 12) chain A residue 79 type sequence M description BINDING SITE FOR RESIDUE SF4 A 300 source : AC3 13) chain A residue 85 type sequence C description BINDING SITE FOR RESIDUE SF4 A 300 source : AC3 14) chain A residue 86 type sequence H description BINDING SITE FOR RESIDUE SF4 A 300 source : AC3 15) chain A residue 87 type sequence C description BINDING SITE FOR RESIDUE SF4 A 300 source : AC3 16) chain A residue 90 type sequence F description BINDING SITE FOR RESIDUE SF4 A 300 source : AC3 17) chain D residue 38 type sequence S description BINDING SITE FOR RESIDUE FES D 400 source : AC4 18) chain D residue 39 type sequence C description BINDING SITE FOR RESIDUE FES D 400 source : AC4 19) chain D residue 40 type sequence R description BINDING SITE FOR RESIDUE FES D 400 source : AC4 20) chain D residue 42 type sequence G description BINDING SITE FOR RESIDUE FES D 400 source : AC4 21) chain D residue 43 type sequence A description BINDING SITE FOR RESIDUE FES D 400 source : AC4 22) chain D residue 44 type sequence C description BINDING SITE FOR RESIDUE FES D 400 source : AC4 23) chain D residue 47 type sequence C description BINDING SITE FOR RESIDUE FES D 400 source : AC4 24) chain D residue 77 type sequence C description BINDING SITE FOR RESIDUE FES D 400 source : AC4 25) chain D residue 39-47 type prosite sequence CRAGACSTC description 2FE2S_FER_1 2Fe-2S ferredoxin-type iron-sulfur binding region signature. CRAGACSTC source prosite : PS00197 26) chain D residue 44 type BINDING sequence C description BINDING => ECO:0000255|PROSITE-ProRule:PRU00465, ECO:0000269|PubMed:7578051 source Swiss-Prot : SWS_FT_FI1 27) chain D residue 47 type BINDING sequence C description BINDING => ECO:0000255|PROSITE-ProRule:PRU00465, ECO:0000269|PubMed:7578051 source Swiss-Prot : SWS_FT_FI1 28) chain D residue 77 type BINDING sequence C description BINDING => ECO:0000255|PROSITE-ProRule:PRU00465, ECO:0000269|PubMed:7578051 source Swiss-Prot : SWS_FT_FI1 29) chain D residue 39 type BINDING sequence C description BINDING => ECO:0000255|PROSITE-ProRule:PRU00465, ECO:0000269|PubMed:7578051 source Swiss-Prot : SWS_FT_FI1 30) chain C residue 40 type SITE sequence D description Deprotonates C-terminal active site Cys source Swiss-Prot : SWS_FT_FI2 31) chain A residue 74 type SITE sequence C description Deprotonates C-terminal active site Cys source Swiss-Prot : SWS_FT_FI2 32) chain A residue 76 type SITE sequence C description Deprotonates C-terminal active site Cys source Swiss-Prot : SWS_FT_FI2 33) chain A residue 85 type SITE sequence C description Deprotonates C-terminal active site Cys source Swiss-Prot : SWS_FT_FI2 34) chain C residue 48 type SITE sequence P description Contributes to redox potential value source Swiss-Prot : SWS_FT_FI3 35) chain C residue 47 type SITE sequence G description Contributes to redox potential value source Swiss-Prot : SWS_FT_FI3

Display surface Download Links