eF-site ID 2pvo-A PDB Code 2pvo Chain A click to enlarge Title Crystal srtucture of the ternary complex between thioredoxin f, ferredoxin, and ferredoxin: thioredoxin reductase Classification ELECTRON TRANSPORT Compound Ferredoxin-thioredoxin reductase, catalytic chain Source Synechocystis sp. (strain PCC 6803 / Kazusa) (FER_SYNY3) Sequence A:  NKTLAAMKNFAEQYAKRTDTYFCSDLSVTAVVIEGLARHK EELGSPLCPCRHYEDKEAEVKNTFWNCPCVPMRERKECHC MLFLTPDNDFAGDAQDIPMETLEEVKASMA Description Functional site 1) chain A residue 80 type sequence R description BINDING SITE FOR RESIDUE SO4 A 201 source : AC1 2) chain A residue 50 type sequence L description BINDING SITE FOR RESIDUE SO4 A 202 source : AC2 3) chain A residue 51 type sequence G description BINDING SITE FOR RESIDUE SO4 A 202 source : AC2 4) chain A residue 52 type sequence S description BINDING SITE FOR RESIDUE SO4 A 202 source : AC2 5) chain A residue 55 type sequence C description BINDING SITE FOR RESIDUE SF4 A 300 source : AC3 6) chain A residue 74 type sequence C description BINDING SITE FOR RESIDUE SF4 A 300 source : AC3 7) chain A residue 76 type sequence C description BINDING SITE FOR RESIDUE SF4 A 300 source : AC3 8) chain A residue 79 type sequence M description BINDING SITE FOR RESIDUE SF4 A 300 source : AC3 9) chain A residue 85 type sequence C description BINDING SITE FOR RESIDUE SF4 A 300 source : AC3 10) chain A residue 86 type sequence H description BINDING SITE FOR RESIDUE SF4 A 300 source : AC3 11) chain A residue 87 type sequence C description BINDING SITE FOR RESIDUE SF4 A 300 source : AC3 12) chain A residue 90 type sequence F description BINDING SITE FOR RESIDUE SF4 A 300 source : AC3 13) chain A residue 74 type SITE sequence C description Deprotonates C-terminal active site Cys source Swiss-Prot : SWS_FT_FI2 14) chain A residue 76 type SITE sequence C description Deprotonates C-terminal active site Cys source Swiss-Prot : SWS_FT_FI2 15) chain A residue 85 type SITE sequence C description Deprotonates C-terminal active site Cys source Swiss-Prot : SWS_FT_FI2

Display surface Download Links