eF-site ID 2pu5-A PDB Code 2pu5 Chain A click to enlarge Title Crystal Structure of a C-C bond hydrolase, BphD, from Burkholderia xenovorans LB400 Classification HYDROLASE Compound 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase Source Paraburkholderia xenovorans (strain LB400) (BPHD_BURXL) Sequence A:  TALTESSTSKFVKINEKGFSDFNIHYNEAGNGETVIMLHG GGPGAGGWSNYYRNVGPFVDAGYRVILKDSPGFNKSDAVV MDEQRGLVNARAVKGLMDALDIDRAHLVGNSMGGATALNF ALEYPDRIGKLILMGPGGLGPSMFAPMPMEGIKLLFKLYA EPSYETLKQMLQVFLYDQSLITEELLQGRWEAIQRQPEHL KNFLISAQKAPLSTWDVTARLGEIKAKTFITWGRDDRFVP LDHGLKLLWNIDDARLHVFSKCGHWAQWEHADEFNRLVID FLRHA Description Functional site 1) chain A residue 41 type sequence G description BINDING SITE FOR RESIDUE MLI A 287 source : AC1 2) chain A residue 42 type sequence G description BINDING SITE FOR RESIDUE MLI A 287 source : AC1 3) chain A residue 43 type sequence G description BINDING SITE FOR RESIDUE MLI A 287 source : AC1 4) chain A residue 46 type sequence A description BINDING SITE FOR RESIDUE MLI A 287 source : AC1 5) chain A residue 51 type sequence N description BINDING SITE FOR RESIDUE MLI A 287 source : AC1 6) chain A residue 111 type sequence N description BINDING SITE FOR RESIDUE MLI A 287 source : AC1 7) chain A residue 112 type sequence S description BINDING SITE FOR RESIDUE MLI A 287 source : AC1 8) chain A residue 175 type sequence F description BINDING SITE FOR RESIDUE MLI A 287 source : AC1 9) chain A residue 190 type sequence R description BINDING SITE FOR RESIDUE MLI A 287 source : AC1 10) chain A residue 239 type sequence F description BINDING SITE FOR RESIDUE MLI A 287 source : AC1 11) chain A residue 265 type sequence H description BINDING SITE FOR RESIDUE MLI A 287 source : AC1 12) chain A residue 266 type sequence W description BINDING SITE FOR RESIDUE MLI A 287 source : AC1 13) chain A residue 265 type ACT_SITE sequence H description Proton acceptor source Swiss-Prot : SWS_FT_FI1 14) chain A residue 42 type BINDING sequence G description source Swiss-Prot : SWS_FT_FI2 15) chain A residue 51 type BINDING sequence N description source Swiss-Prot : SWS_FT_FI2 16) chain A residue 111 type BINDING sequence N description source Swiss-Prot : SWS_FT_FI2 17) chain A residue 180 type BINDING sequence S description source Swiss-Prot : SWS_FT_FI2 18) chain A residue 190 type BINDING sequence R description source Swiss-Prot : SWS_FT_FI2 19) chain A residue 266 type BINDING sequence W description source Swiss-Prot : SWS_FT_FI2 20) chain A residue 112 type SITE sequence S description Transition state stabilizer source Swiss-Prot : SWS_FT_FI3

Display surface Download Links