eF-site ID 2pgi-A
PDB Code 2pgi
Chain A

click to enlarge
Title THE CRYSTAL STRUCTURE OF PHOSPHOGLUCOSE ISOMERASE-AN ENZYME WITH AUTOCRINE MOTILITY FACTOR ACTIVITY IN TUMOR CELLS
Classification ISOMERASE
Compound PHOSPHOGLUCOSE ISOMERASE
Source Geobacillus stearothermophilus (Bacillus stearothermophilus) (G6PIB_BACST)
Sequence A:  AISFDYSNALPFMQENELDYLSEFVKAAHHMLHERKGPGS
DFLGWVDWPIRYDKNEFSRIKQAAERIRNHSDALVVIGIG
GSYLGARAAIEALSHTFHNQMNDTTQIYFAGQNISSTYIS
HLLDVLEGKDLSINVISKSGTTTEPAIAFRIFRDYMEKKY
GKEEARKRIYVTTDRTKGALKKLADQEGYETFVIPDNIGG
RYSVLTAVGLLPIAVAGLNIDRMMEGAASAYHKYNNPDLL
TNESYQYAAVRNILYRKGKAIELLVNYEPSLHYVSEWWKQ
LFGESEGKDQKGLFPASVDFTTDLHSMGQYVQEGRRNLIE
TVLHVKKPQIELTIQEDPENIDGLNFLAGKTLDEVNKKAF
QGTLLAHVDGGVPNLIVELDEMNEYTFGEMVYFFEKACGI
SGHLLGVNPFDQPGVEAYKKNMFALLGKPGFEDEKAALMK
RL
Description (1)  PHOSPHOGLUCOSE ISOMERASE


Functional site

1) chain A
residue 306
type ACT_SITE
ligand
sequence H
description By similarity.
source Swiss-Prot : SWS_FT_FI1

2) chain A
residue 420
type ACT_SITE
ligand
sequence K
description By similarity.
source Swiss-Prot : SWS_FT_FI1

3) chain A
residue 285
type ACT_SITE
ligand
sequence E
description Proton donor (By similarity).
source Swiss-Prot : SWS_FT_FI2

4) chain A
residue 403-420
type prosite
ligand
sequence GHLLGVNPFDQPGVEAYK
description Phosphoglucose isomerase signature 2. [GSA]-x-[LIVMCAYQS]-[LIVMFYWN]-x(4)-[FY]-[DNTH]-Q-x-[GA]-[IV]-[EQST]
source prosite : PS00174

5) chain A
residue 197-210
type prosite
ligand
sequence DNIGGRYSVLTAVG
description Phosphoglucose isomerase signature 1. [DENSA]-x-[LIVM]-[GP]-G-R-[FY]-[ST]-[LIVMFSTAP]-x-[GSTA]-[PSTACM]
source prosite : PS00765

6) chain A
residue 201
type catalytic
ligand
sequence G
description Annotated By Reference To The Literature 1dqr
source CSA : CSA1

7) chain A
residue 145
type catalytic
ligand
sequence E
description Annotated By Reference To The Literature 1dqr
source CSA : CSA1

8) chain A
residue 285
type catalytic
ligand
sequence E
description Annotated By Reference To The Literature 1dqr
source CSA : CSA1

9) chain A
residue 139
type catalytic
ligand
sequence K
description Annotated By Reference To The Literature 1dqr
source CSA : CSA1

10) chain A
residue 420
type catalytic
ligand
sequence K
description Annotated By Reference To The Literature 1dqr
source CSA : CSA1

11) chain A
residue 202
type catalytic
ligand
sequence R
description Annotated By Reference To The Literature 1dqr
source CSA : CSA1

12) chain A
residue 306
type catalytic
ligand
sequence H
description Annotated By Reference To The Literature 1dqr
source CSA : CSA2


Display surface

Download
Links