eF-site ID 2p80_12-ABCD PDB Code 2p80 Model 12 Chain A, B, C, D click to enlarge Title Solution structure of the complex between nitrite reductase and pseudoazurin from A. faecalis Classification OXIDOREDUCTASE Compound Copper-containing nitrite reductase Source Alcaligenes faecalis (AZUP_ALCFA) Sequence A:  TAAEIAALPRQKVELVDPPFVHAHSQVAEGGPKVVEFTMV IEEKKIVIDDAGTEVHAMAFNGTVPGPLMVVHQDDYLELT LINPETNTLMHNIDFHAATGALGGGGLTEINPGEKTILRF KATKPGVFVYHCAPPGMVPWHVVSGMNGAIMVLPREGLHD GKGKALTYDKIYYVGEQDFYVPRDENGKYKKYEAPGDAYE DTVKVMRTLTPTHVVFNGAVGALTGDKAMTAAVGEKVLIV HSQANRDTRPHLIGGHGDYVWATGKFNTPPDVDQETWFIP GGAAGAAFYTFQQPGIYAYVNHNLIEAFELGAAAHFKVTG EWNDDLMTSVLAPSG B:  ATAAEIAALPRQKVELVDPPFVHAHSQVAEGGPKVVEFTM VIEEKKIVIDDAGTEVHAMAFNGTVPGPLMVVHQDDYLEL TLINPETNTLMHNIDFHAATGALGGGGLTEINPGEKTILR FKATKPGVFVYHCAPPGMVPWHVVSGMNGAIMVLPREGLH DGKGKALTYDKIYYVGEQDFYVPRDENGKYKKYEAPGDAY EDTVKVMRTLTPTHVVFNGAVGALTGDKAMTAAVGEKVLI VHSQANRDTRPHLIGGHGDYVWATGKFNTPPDVDQETWFI PGGAAGAAFYTFQQPGIYAYVNHNLIEAFELGAAAHFKVT GEWNDDLMTSVLAPSG C:  ATAAEIAALPRQKVELVDPPFVHAHSQVAEGGPKVVEFTM VIEEKKIVIDDAGTEVHAMAFNGTVPGPLMVVHQDDYLEL TLINPETNTLMHNIDFHAATGALGGGGLTEINPGEKTILR FKATKPGVFVYHCAPPGMVPWHVVSGMNGAIMVLPREGLH DGKGKALTYDKIYYVGEQDFYVPRDENGKYKKYEAPGDAY EDTVKVMRTLTPTHVVFNGAVGALTGDKAMTAAVGEKVLI VHSQANRDTRPHLIGGHGDYVWATGKFNTPPDVDQETWFI PGGAAGAAFYTFQQPGIYAYVNHNLIEAFELGAAAHFKVT GEWNDDLMTSVLAPSG D:  ENIEVHMLNKGAEGAMVFEPAYIKANPGDTVTFIPVDKGH NVESIKDMIPEGAEKFKSKINENYVLTVTQPGAYLVKCTP HYAMGMIALIAVGDSPANLDQIVSAKKPKIVQERLEKVIA SAK Description Functional site 1) chain A residue 95 type sequence H description BINDING SITE FOR RESIDUE CU A 345 source : AC1 2) chain A residue 136 type sequence C description BINDING SITE FOR RESIDUE CU A 345 source : AC1 3) chain A residue 145 type sequence H description BINDING SITE FOR RESIDUE CU A 345 source : AC1 4) chain A residue 150 type sequence M description BINDING SITE FOR RESIDUE CU A 345 source : AC1 5) chain A residue 100 type sequence H description BINDING SITE FOR RESIDUE CU A 346 source : AC2 6) chain A residue 135 type sequence H description BINDING SITE FOR RESIDUE CU A 346 source : AC2 7) chain B residue 306 type sequence H description BINDING SITE FOR RESIDUE CU A 346 source : AC2 8) chain B residue 95 type sequence H description BINDING SITE FOR RESIDUE CU B 345 source : AC3 9) chain B residue 136 type sequence C description BINDING SITE FOR RESIDUE CU B 345 source : AC3 10) chain B residue 145 type sequence H description BINDING SITE FOR RESIDUE CU B 345 source : AC3 11) chain B residue 150 type sequence M description BINDING SITE FOR RESIDUE CU B 345 source : AC3 12) chain B residue 100 type sequence H description BINDING SITE FOR RESIDUE CU B 346 source : AC4 13) chain B residue 135 type sequence H description BINDING SITE FOR RESIDUE CU B 346 source : AC4 14) chain C residue 306 type sequence H description BINDING SITE FOR RESIDUE CU B 346 source : AC4 15) chain C residue 95 type sequence H description BINDING SITE FOR RESIDUE CU C 345 source : AC5 16) chain C residue 136 type sequence C description BINDING SITE FOR RESIDUE CU C 345 source : AC5 17) chain C residue 145 type sequence H description BINDING SITE FOR RESIDUE CU C 345 source : AC5 18) chain C residue 150 type sequence M description BINDING SITE FOR RESIDUE CU C 345 source : AC5 19) chain A residue 306 type sequence H description BINDING SITE FOR RESIDUE CU C 346 source : AC6 20) chain C residue 100 type sequence H description BINDING SITE FOR RESIDUE CU C 346 source : AC6 21) chain C residue 135 type sequence H description BINDING SITE FOR RESIDUE CU C 346 source : AC6 22) chain D residue 40 type sequence H description BINDING SITE FOR RESIDUE CU D 124 source : AC7 23) chain D residue 78 type sequence C description BINDING SITE FOR RESIDUE CU D 124 source : AC7 24) chain D residue 81 type sequence H description BINDING SITE FOR RESIDUE CU D 124 source : AC7 25) chain D residue 86 type sequence M description BINDING SITE FOR RESIDUE CU D 124 source : AC7 26) chain A residue 231 type sequence K description BINDING SITE FOR RESIDUE GD A 347 source : AC8 27) chain C residue 231 type sequence K description BINDING SITE FOR RESIDUE GD C 347 source : AC9 28) chain D residue 72-86 type prosite sequence GAYLVKCTPHYAMGM description COPPER_BLUE Type-1 copper (blue) proteins signature. Ga.YlVKCt.P.HyamgM source prosite : PS00196 29) chain D residue 40 type BINDING sequence H description BINDING => ECO:0000269|PubMed:2909547 source Swiss-Prot : SWS_FT_FI1 30) chain D residue 78 type BINDING sequence C description BINDING => ECO:0000269|PubMed:2909547 source Swiss-Prot : SWS_FT_FI1 31) chain D residue 81 type BINDING sequence H description BINDING => ECO:0000269|PubMed:2909547 source Swiss-Prot : SWS_FT_FI1 32) chain D residue 86 type BINDING sequence M description BINDING => ECO:0000269|PubMed:2909547 source Swiss-Prot : SWS_FT_FI1 33) chain A residue 100 type BINDING sequence H description type 2 copper site source Swiss-Prot : SWS_FT_FI2 34) chain A residue 135 type BINDING sequence H description type 2 copper site source Swiss-Prot : SWS_FT_FI2 35) chain B residue 100 type BINDING sequence H description type 2 copper site source Swiss-Prot : SWS_FT_FI2 36) chain B residue 135 type BINDING sequence H description type 2 copper site source Swiss-Prot : SWS_FT_FI2 37) chain C residue 100 type BINDING sequence H description type 2 copper site source Swiss-Prot : SWS_FT_FI2 38) chain C residue 135 type BINDING sequence H description type 2 copper site source Swiss-Prot : SWS_FT_FI2 39) chain A residue 136 type BINDING sequence C description type 1 copper site source Swiss-Prot : SWS_FT_FI3 40) chain A residue 145 type BINDING sequence H description type 1 copper site source Swiss-Prot : SWS_FT_FI3 41) chain A residue 150 type BINDING sequence M description type 1 copper site source Swiss-Prot : SWS_FT_FI3 42) chain B residue 136 type BINDING sequence C description type 1 copper site source Swiss-Prot : SWS_FT_FI3 43) chain B residue 145 type BINDING sequence H description type 1 copper site source Swiss-Prot : SWS_FT_FI3 44) chain B residue 150 type BINDING sequence M description type 1 copper site source Swiss-Prot : SWS_FT_FI3 45) chain C residue 136 type BINDING sequence C description type 1 copper site source Swiss-Prot : SWS_FT_FI3 46) chain C residue 145 type BINDING sequence H description type 1 copper site source Swiss-Prot : SWS_FT_FI3 47) chain C residue 150 type BINDING sequence M description type 1 copper site source Swiss-Prot : SWS_FT_FI3 48) chain A residue 306 type BINDING sequence H description type 2 copper site => ECO:0000269|PubMed:8172899 source Swiss-Prot : SWS_FT_FI4 49) chain B residue 306 type BINDING sequence H description type 2 copper site => ECO:0000269|PubMed:8172899 source Swiss-Prot : SWS_FT_FI4 50) chain C residue 306 type BINDING sequence H description type 2 copper site => ECO:0000269|PubMed:8172899 source Swiss-Prot : SWS_FT_FI4

Display surface Download Links