eF-site ID 2p6z-A PDB Code 2p6z Chain A click to enlarge Title Enzymatic and Structural Characterisation of Amphinase, a Novel Cytotoxic Ribonuclease from Rana pipiens Oocytes Classification HYDROLASE Compound Recombinant Amphinase-2 Source Lithobates pipiens (Northern leopard frog) (Rana pipiens) (AMPS2_RANPI) Sequence A:  KEDREWEKFKTKHITSQSVADFNCNRTMNDPAYTPDGQCK PINTFIHSTTGPVKEICRRATGRVNKSSTQQFTLTTCKNP IRCKYSQSNTTNFICITCRDNYPVHFVKTGKC Description Functional site 1) chain A residue 73 type sequence Q description BINDING SITE FOR RESIDUE NA A 402 source : AC2 2) chain A residue 93 type sequence T description BINDING SITE FOR RESIDUE NA A 402 source : AC2 3) chain A residue 14 type sequence K description BINDING SITE FOR RESIDUE CIT A 501 source : AC4 4) chain A residue 15 type sequence H description BINDING SITE FOR RESIDUE CIT A 501 source : AC4 5) chain A residue 45 type sequence N description BINDING SITE FOR RESIDUE CIT A 501 source : AC4 6) chain A residue 46 type sequence T description BINDING SITE FOR RESIDUE CIT A 501 source : AC4 7) chain A residue 107 type sequence H description BINDING SITE FOR RESIDUE CIT A 501 source : AC4 8) chain A residue 108 type sequence F description BINDING SITE FOR RESIDUE CIT A 501 source : AC4 9) chain A residue 27 type CARBOHYD sequence N description N-linked (GlcNAc...) asparagine => ECO:0000269|PubMed:17560606 source Swiss-Prot : SWS_FT_FI4 10) chain A residue 15 type ACT_SITE sequence H description Proton acceptor => ECO:0000250|UniProtKB:P11916 source Swiss-Prot : SWS_FT_FI1 11) chain A residue 107 type ACT_SITE sequence H description Proton donor => ECO:0000250|UniProtKB:P11916 source Swiss-Prot : SWS_FT_FI2 12) chain A residue 42 type BINDING sequence K description BINDING => ECO:0000250|UniProtKB:P11916 source Swiss-Prot : SWS_FT_FI3 13) chain A residue 41-47 type prosite sequence CKPINTF description RNASE_PANCREATIC Pancreatic ribonuclease family signature. CKpiNTF source prosite : PS00127 14) chain A residue 67 type CARBOHYD sequence N description N-linked (GlcNAc...) asparagine => ECO:0000255 source Swiss-Prot : SWS_FT_FI5 15) chain A residue 91 type CARBOHYD sequence N description N-linked (GlcNAc...) asparagine => ECO:0000255 source Swiss-Prot : SWS_FT_FI5

Display surface Download Links