eF-site ID 2p5u-C
PDB Code 2p5u
Chain C

click to enlarge
Title Crystal structure of Thermus thermophilus HB8 UDP-glucose 4-epimerase complex with NAD
Classification ISOMERASE
Compound UDP-glucose 4-epimerase
Source Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) (Q5SKQ2_THET8)
Sequence C:  MRVLVTGGAGFIGSHIVEDLLARGLEVAVLDNLATGKREN
VPKGVPFFRVDLRDKEGVERAFREFRPTHVSHQAAQASVK
VSVEDPVLDFEVNLLGGLNLLEACRQYGVEKLVFASTGGA
IYGEVPEGERAEETWPPRPKSPYAASKAAFEHYLSVYGQS
YGLKWVSLRYGNVYGPRQDPHGEAGVVAIFAERVLKGLPV
TLYARKTPGDEGCVRDYVYVGDVAEAHALALFSLEGIYNV
GTGEGHTTREVLMAVAEAAGKAPEVQPAPPRPGDLERSVL
SPLKLMAHGWRPKVGFQEGIRLTVDHFRGAV
Description (1)  UDP-glucose 4-epimerase (E.C.5.1.3.2)


Functional site

1) chain C
residue 6
type
ligand
sequence T
description BINDING SITE FOR RESIDUE NAD C 1118
source : AC3

2) chain C
residue 9
type
ligand
sequence A
description BINDING SITE FOR RESIDUE NAD C 1118
source : AC3

3) chain C
residue 10
type
ligand
sequence G
description BINDING SITE FOR RESIDUE NAD C 1118
source : AC3

4) chain C
residue 11
type
ligand
sequence F
description BINDING SITE FOR RESIDUE NAD C 1118
source : AC3

5) chain C
residue 12
type
ligand
sequence I
description BINDING SITE FOR RESIDUE NAD C 1118
source : AC3

6) chain C
residue 31
type
ligand
sequence D
description BINDING SITE FOR RESIDUE NAD C 1118
source : AC3

7) chain C
residue 32
type
ligand
sequence N
description BINDING SITE FOR RESIDUE NAD C 1118
source : AC3

8) chain C
residue 33
type
ligand
sequence L
description BINDING SITE FOR RESIDUE NAD C 1118
source : AC3

9) chain C
residue 34
type
ligand
sequence A
description BINDING SITE FOR RESIDUE NAD C 1118
source : AC3

10) chain C
residue 35
type
ligand
sequence T
description BINDING SITE FOR RESIDUE NAD C 1118
source : AC3

11) chain C
residue 36
type
ligand
sequence G
description BINDING SITE FOR RESIDUE NAD C 1118
source : AC3

12) chain C
residue 50
type
ligand
sequence V
description BINDING SITE FOR RESIDUE NAD C 1118
source : AC3

13) chain C
residue 51
type
ligand
sequence D
description BINDING SITE FOR RESIDUE NAD C 1118
source : AC3

14) chain C
residue 52
type
ligand
sequence L
description BINDING SITE FOR RESIDUE NAD C 1118
source : AC3

15) chain C
residue 73
type
ligand
sequence Q
description BINDING SITE FOR RESIDUE NAD C 1118
source : AC3

16) chain C
residue 74
type
ligand
sequence A
description BINDING SITE FOR RESIDUE NAD C 1118
source : AC3

17) chain C
residue 75
type
ligand
sequence A
description BINDING SITE FOR RESIDUE NAD C 1118
source : AC3

18) chain C
residue 77
type
ligand
sequence A
description BINDING SITE FOR RESIDUE NAD C 1118
source : AC3

19) chain C
residue 92
type
ligand
sequence V
description BINDING SITE FOR RESIDUE NAD C 1118
source : AC3

20) chain C
residue 115
type
ligand
sequence A
description BINDING SITE FOR RESIDUE NAD C 1118
source : AC3

21) chain C
residue 116
type
ligand
sequence S
description BINDING SITE FOR RESIDUE NAD C 1118
source : AC3

22) chain C
residue 143
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE NAD C 1118
source : AC3

23) chain C
residue 147
type
ligand
sequence K
description BINDING SITE FOR RESIDUE NAD C 1118
source : AC3

24) chain C
residue 171
type
ligand
sequence G
description BINDING SITE FOR RESIDUE NAD C 1118
source : AC3

25) chain C
residue 173
type
ligand
sequence V
description BINDING SITE FOR RESIDUE NAD C 1118
source : AC3

26) chain C
residue 183
type
ligand
sequence E
description BINDING SITE FOR RESIDUE NAD C 1118
source : AC3

27) chain C
residue 184
type
ligand
sequence A
description BINDING SITE FOR RESIDUE NAD C 1118
source : AC3

28) chain C
residue 73
type BINDING
ligand
sequence Q
description NAD; via carbonyl oxygen. {ECO:0000213|PDB:2P5U, ECO:0000213|PDB: 2P5Y}.
source Swiss-Prot : SWS_FT_FI11

29) chain C
residue 143
type BINDING
ligand
sequence Y
description NAD. {ECO:0000213|PDB:2P5U, ECO:0000213|PDB:2P5Y}.
source Swiss-Prot : SWS_FT_FI12

30) chain C
residue 147
type BINDING
ligand
sequence K
description NAD. {ECO:0000213|PDB:2P5U, ECO:0000213|PDB:2P5Y}.
source Swiss-Prot : SWS_FT_FI12

31) chain C
residue 173
type BINDING
ligand
sequence V
description NAD; via amide nitrogen. {ECO:0000213|PDB:2P5U, ECO:0000213|PDB: 2P5Y}.
source Swiss-Prot : SWS_FT_FI13

32) chain C
residue 10-12
type NP_BIND
ligand
sequence GFI
description NAD. {ECO:0000213|PDB:2P5U, ECO:0000213|PDB:2P5Y}.
source Swiss-Prot : SWS_FT_FI14

33) chain C
residue 31-36
type NP_BIND
ligand
sequence DNLATG
description NAD. {ECO:0000213|PDB:2P5U, ECO:0000213|PDB:2P5Y}.
source Swiss-Prot : SWS_FT_FI14

34) chain C
residue 51-52
type NP_BIND
ligand
sequence DL
description NAD. {ECO:0000213|PDB:2P5U, ECO:0000213|PDB:2P5Y}.
source Swiss-Prot : SWS_FT_FI14

35) chain C
residue 183-184
type NP_BIND
ligand
sequence EA
description NAD. {ECO:0000213|PDB:2P5U}.
source Swiss-Prot : SWS_FT_FI15

36) chain C
residue 6-7
type binding
ligand NAD: NICOTINAMIDE-ADENINE-DINUCLEOTIDE
sequence TG
description NICOTINAMIDE-ADENINE-DINUCLEOTIDE binding site
source pdb_hetatom : NAD_2p5u_C_1118

37) chain C
residue 9-13
type binding
ligand NAD: NICOTINAMIDE-ADENINE-DINUCLEOTIDE
sequence AGFIG
description NICOTINAMIDE-ADENINE-DINUCLEOTIDE binding site
source pdb_hetatom : NAD_2p5u_C_1118

38) chain C
residue 30-37
type binding
ligand NAD: NICOTINAMIDE-ADENINE-DINUCLEOTIDE
sequence LDNLATGK
description NICOTINAMIDE-ADENINE-DINUCLEOTIDE binding site
source pdb_hetatom : NAD_2p5u_C_1118

39) chain C
residue 50-53
type binding
ligand NAD: NICOTINAMIDE-ADENINE-DINUCLEOTIDE
sequence VDLR
description NICOTINAMIDE-ADENINE-DINUCLEOTIDE binding site
source pdb_hetatom : NAD_2p5u_C_1118

40) chain C
residue 73-77
type binding
ligand NAD: NICOTINAMIDE-ADENINE-DINUCLEOTIDE
sequence QAAQA
description NICOTINAMIDE-ADENINE-DINUCLEOTIDE binding site
source pdb_hetatom : NAD_2p5u_C_1118

41) chain C
residue 92
type binding
ligand NAD: NICOTINAMIDE-ADENINE-DINUCLEOTIDE
sequence V
description NICOTINAMIDE-ADENINE-DINUCLEOTIDE binding site
source pdb_hetatom : NAD_2p5u_C_1118

42) chain C
residue 115-117
type binding
ligand NAD: NICOTINAMIDE-ADENINE-DINUCLEOTIDE
sequence AST
description NICOTINAMIDE-ADENINE-DINUCLEOTIDE binding site
source pdb_hetatom : NAD_2p5u_C_1118

43) chain C
residue 143
type binding
ligand NAD: NICOTINAMIDE-ADENINE-DINUCLEOTIDE
sequence Y
description NICOTINAMIDE-ADENINE-DINUCLEOTIDE binding site
source pdb_hetatom : NAD_2p5u_C_1118

44) chain C
residue 147
type binding
ligand NAD: NICOTINAMIDE-ADENINE-DINUCLEOTIDE
sequence K
description NICOTINAMIDE-ADENINE-DINUCLEOTIDE binding site
source pdb_hetatom : NAD_2p5u_C_1118

45) chain C
residue 170-173
type binding
ligand NAD: NICOTINAMIDE-ADENINE-DINUCLEOTIDE
sequence YGNV
description NICOTINAMIDE-ADENINE-DINUCLEOTIDE binding site
source pdb_hetatom : NAD_2p5u_C_1118

46) chain C
residue 179
type binding
ligand NAD: NICOTINAMIDE-ADENINE-DINUCLEOTIDE
sequence D
description NICOTINAMIDE-ADENINE-DINUCLEOTIDE binding site
source pdb_hetatom : NAD_2p5u_C_1118

47) chain C
residue 182-184
type binding
ligand NAD: NICOTINAMIDE-ADENINE-DINUCLEOTIDE
sequence GEA
description NICOTINAMIDE-ADENINE-DINUCLEOTIDE binding site
source pdb_hetatom : NAD_2p5u_C_1118

48) chain C
residue 117
type catalytic
ligand
sequence T
description Annotated By Reference To The Literature 1eq2
source CSA : CSA3

49) chain C
residue 143
type catalytic
ligand
sequence Y
description Annotated By Reference To The Literature 1eq2
source CSA : CSA3

50) chain C
residue 147
type catalytic
ligand
sequence K
description Annotated By Reference To The Literature 1eq2
source CSA : CSA3

51) chain C
residue 143
type catalytic
ligand
sequence Y
description Annotated By Reference To The Literature 1eq2
source CSA : CSA7

52) chain C
residue 147
type catalytic
ligand
sequence K
description Annotated By Reference To The Literature 1eq2
source CSA : CSA7


Display surface

Download
Links