eF-site ID 2p5u-ABCD
PDB Code 2p5u
Chain A, B, C, D

click to enlarge
Title Crystal structure of Thermus thermophilus HB8 UDP-glucose 4-epimerase complex with NAD
Classification ISOMERASE
Compound UDP-glucose 4-epimerase
Source Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) (Q5SKQ2_THET8)
Sequence A:  MRVLVTGGAGFIGSHIVEDLLARGLEVAVLDNLATGKREN
VPKGVPFFRVDLRDKEGVERAFREFRPTHVSHQAAQASVK
VSVEDPVLDFEVNLLGGLNLLEACRQYGVEKLVFASTGGA
IYGEVPEGERAEETWPPRPKSPYAASKAAFEHYLSVYGQS
YGLKWVSLRYGNVYGPRQDPHGEAGVVAIFAERVLKGLPV
TLYARKTPGDEGCVRDYVYVGDVAEAHALALFSLEGIYNV
GTGEGHTTREVLMAVAEAAGKAPEVQPAPPRPGDLERSVL
SPLKLMAHGWRPKVGFQEGIRLTVDHFRGAV
B:  MRVLVTGGAGFIGSHIVEDLLARGLEVAVLDNLATGKREN
VPKGVPFFRVDLRDKEGVERAFREFRPTHVSHQAAQASVK
VSVEDPVLDFEVNLLGGLNLLEACRQYGVEKLVFASTGGA
IYGEVPEGERAEETWPPRPKSPYAASKAAFEHYLSVYGQS
YGLKWVSLRYGNVYGPRQDPHGEAGVVAIFAERVLKGLPV
TLYARKTPGDEGCVRDYVYVGDVAEAHALALFSLEGIYNV
GTGEGHTTREVLMAVAEAAGKAPEVQPAPPRPGDLERSVL
SPLKLMAHGWRPKVGFQEGIRLTVDHFRGAV
C:  MRVLVTGGAGFIGSHIVEDLLARGLEVAVLDNLATGKREN
VPKGVPFFRVDLRDKEGVERAFREFRPTHVSHQAAQASVK
VSVEDPVLDFEVNLLGGLNLLEACRQYGVEKLVFASTGGA
IYGEVPEGERAEETWPPRPKSPYAASKAAFEHYLSVYGQS
YGLKWVSLRYGNVYGPRQDPHGEAGVVAIFAERVLKGLPV
TLYARKTPGDEGCVRDYVYVGDVAEAHALALFSLEGIYNV
GTGEGHTTREVLMAVAEAAGKAPEVQPAPPRPGDLERSVL
SPLKLMAHGWRPKVGFQEGIRLTVDHFRGAV
D:  MRVLVTGGAGFIGSHIVEDLLARGLEVAVLDNLATGKREN
VPKGVPFFRVDLRDKEGVERAFREFRPTHVSHQAAQASVK
VSVEDPVLDFEVNLLGGLNLLEACRQYGVEKLVFASTGGA
IYGEVPEGERAEETWPPRPKSPYAASKAAFEHYLSVYGQS
YGLKWVSLRYGNVYGPRQDPHGEAGVVAIFAERVLKGLPV
TLYARKTPGDEGCVRDYVYVGDVAEAHALALFSLEGIYNV
GTGEGHTTREVLMAVAEAAGKAPEVQPAPPRPGDLERSVL
SPLKLMAHGWRPKVGFQEGIRLTVDHFRGAV
Description (1)  UDP-glucose 4-epimerase (E.C.5.1.3.2)


Functional site

1) chain A
residue 7
type
ligand
sequence G
description BINDING SITE FOR RESIDUE NAD A 1118
source : AC1

2) chain A
residue 9
type
ligand
sequence A
description BINDING SITE FOR RESIDUE NAD A 1118
source : AC1

3) chain A
residue 10
type
ligand
sequence G
description BINDING SITE FOR RESIDUE NAD A 1118
source : AC1

4) chain A
residue 11
type
ligand
sequence F
description BINDING SITE FOR RESIDUE NAD A 1118
source : AC1

5) chain A
residue 12
type
ligand
sequence I
description BINDING SITE FOR RESIDUE NAD A 1118
source : AC1

6) chain A
residue 31
type
ligand
sequence D
description BINDING SITE FOR RESIDUE NAD A 1118
source : AC1

7) chain A
residue 32
type
ligand
sequence N
description BINDING SITE FOR RESIDUE NAD A 1118
source : AC1

8) chain A
residue 33
type
ligand
sequence L
description BINDING SITE FOR RESIDUE NAD A 1118
source : AC1

9) chain A
residue 34
type
ligand
sequence A
description BINDING SITE FOR RESIDUE NAD A 1118
source : AC1

10) chain A
residue 35
type
ligand
sequence T
description BINDING SITE FOR RESIDUE NAD A 1118
source : AC1

11) chain A
residue 36
type
ligand
sequence G
description BINDING SITE FOR RESIDUE NAD A 1118
source : AC1

12) chain A
residue 50
type
ligand
sequence V
description BINDING SITE FOR RESIDUE NAD A 1118
source : AC1

13) chain A
residue 51
type
ligand
sequence D
description BINDING SITE FOR RESIDUE NAD A 1118
source : AC1

14) chain A
residue 52
type
ligand
sequence L
description BINDING SITE FOR RESIDUE NAD A 1118
source : AC1

15) chain A
residue 73
type
ligand
sequence Q
description BINDING SITE FOR RESIDUE NAD A 1118
source : AC1

16) chain A
residue 74
type
ligand
sequence A
description BINDING SITE FOR RESIDUE NAD A 1118
source : AC1

17) chain A
residue 75
type
ligand
sequence A
description BINDING SITE FOR RESIDUE NAD A 1118
source : AC1

18) chain A
residue 77
type
ligand
sequence A
description BINDING SITE FOR RESIDUE NAD A 1118
source : AC1

19) chain A
residue 115
type
ligand
sequence A
description BINDING SITE FOR RESIDUE NAD A 1118
source : AC1

20) chain A
residue 116
type
ligand
sequence S
description BINDING SITE FOR RESIDUE NAD A 1118
source : AC1

21) chain A
residue 143
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE NAD A 1118
source : AC1

22) chain A
residue 147
type
ligand
sequence K
description BINDING SITE FOR RESIDUE NAD A 1118
source : AC1

23) chain A
residue 170
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE NAD A 1118
source : AC1

24) chain A
residue 171
type
ligand
sequence G
description BINDING SITE FOR RESIDUE NAD A 1118
source : AC1

25) chain A
residue 173
type
ligand
sequence V
description BINDING SITE FOR RESIDUE NAD A 1118
source : AC1

26) chain A
residue 184
type
ligand
sequence A
description BINDING SITE FOR RESIDUE NAD A 1118
source : AC1

27) chain B
residue 7
type
ligand
sequence G
description BINDING SITE FOR RESIDUE NAD B 1118
source : AC2

28) chain B
residue 9
type
ligand
sequence A
description BINDING SITE FOR RESIDUE NAD B 1118
source : AC2

29) chain B
residue 10
type
ligand
sequence G
description BINDING SITE FOR RESIDUE NAD B 1118
source : AC2

30) chain B
residue 11
type
ligand
sequence F
description BINDING SITE FOR RESIDUE NAD B 1118
source : AC2

31) chain B
residue 12
type
ligand
sequence I
description BINDING SITE FOR RESIDUE NAD B 1118
source : AC2

32) chain B
residue 31
type
ligand
sequence D
description BINDING SITE FOR RESIDUE NAD B 1118
source : AC2

33) chain B
residue 32
type
ligand
sequence N
description BINDING SITE FOR RESIDUE NAD B 1118
source : AC2

34) chain B
residue 33
type
ligand
sequence L
description BINDING SITE FOR RESIDUE NAD B 1118
source : AC2

35) chain B
residue 34
type
ligand
sequence A
description BINDING SITE FOR RESIDUE NAD B 1118
source : AC2

36) chain B
residue 35
type
ligand
sequence T
description BINDING SITE FOR RESIDUE NAD B 1118
source : AC2

37) chain B
residue 36
type
ligand
sequence G
description BINDING SITE FOR RESIDUE NAD B 1118
source : AC2

38) chain B
residue 50
type
ligand
sequence V
description BINDING SITE FOR RESIDUE NAD B 1118
source : AC2

39) chain B
residue 51
type
ligand
sequence D
description BINDING SITE FOR RESIDUE NAD B 1118
source : AC2

40) chain B
residue 52
type
ligand
sequence L
description BINDING SITE FOR RESIDUE NAD B 1118
source : AC2

41) chain B
residue 73
type
ligand
sequence Q
description BINDING SITE FOR RESIDUE NAD B 1118
source : AC2

42) chain B
residue 74
type
ligand
sequence A
description BINDING SITE FOR RESIDUE NAD B 1118
source : AC2

43) chain B
residue 75
type
ligand
sequence A
description BINDING SITE FOR RESIDUE NAD B 1118
source : AC2

44) chain B
residue 77
type
ligand
sequence A
description BINDING SITE FOR RESIDUE NAD B 1118
source : AC2

45) chain B
residue 92
type
ligand
sequence V
description BINDING SITE FOR RESIDUE NAD B 1118
source : AC2

46) chain B
residue 115
type
ligand
sequence A
description BINDING SITE FOR RESIDUE NAD B 1118
source : AC2

47) chain B
residue 116
type
ligand
sequence S
description BINDING SITE FOR RESIDUE NAD B 1118
source : AC2

48) chain B
residue 143
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE NAD B 1118
source : AC2

49) chain B
residue 147
type
ligand
sequence K
description BINDING SITE FOR RESIDUE NAD B 1118
source : AC2

50) chain B
residue 171
type
ligand
sequence G
description BINDING SITE FOR RESIDUE NAD B 1118
source : AC2

51) chain B
residue 173
type
ligand
sequence V
description BINDING SITE FOR RESIDUE NAD B 1118
source : AC2

52) chain B
residue 183
type
ligand
sequence E
description BINDING SITE FOR RESIDUE NAD B 1118
source : AC2

53) chain B
residue 184
type
ligand
sequence A
description BINDING SITE FOR RESIDUE NAD B 1118
source : AC2

54) chain C
residue 6
type
ligand
sequence T
description BINDING SITE FOR RESIDUE NAD C 1118
source : AC3

55) chain C
residue 9
type
ligand
sequence A
description BINDING SITE FOR RESIDUE NAD C 1118
source : AC3

56) chain C
residue 10
type
ligand
sequence G
description BINDING SITE FOR RESIDUE NAD C 1118
source : AC3

57) chain C
residue 11
type
ligand
sequence F
description BINDING SITE FOR RESIDUE NAD C 1118
source : AC3

58) chain C
residue 12
type
ligand
sequence I
description BINDING SITE FOR RESIDUE NAD C 1118
source : AC3

59) chain C
residue 31
type
ligand
sequence D
description BINDING SITE FOR RESIDUE NAD C 1118
source : AC3

60) chain C
residue 32
type
ligand
sequence N
description BINDING SITE FOR RESIDUE NAD C 1118
source : AC3

61) chain C
residue 33
type
ligand
sequence L
description BINDING SITE FOR RESIDUE NAD C 1118
source : AC3

62) chain C
residue 34
type
ligand
sequence A
description BINDING SITE FOR RESIDUE NAD C 1118
source : AC3

63) chain C
residue 35
type
ligand
sequence T
description BINDING SITE FOR RESIDUE NAD C 1118
source : AC3

64) chain C
residue 36
type
ligand
sequence G
description BINDING SITE FOR RESIDUE NAD C 1118
source : AC3

65) chain C
residue 50
type
ligand
sequence V
description BINDING SITE FOR RESIDUE NAD C 1118
source : AC3

66) chain C
residue 51
type
ligand
sequence D
description BINDING SITE FOR RESIDUE NAD C 1118
source : AC3

67) chain C
residue 52
type
ligand
sequence L
description BINDING SITE FOR RESIDUE NAD C 1118
source : AC3

68) chain C
residue 73
type
ligand
sequence Q
description BINDING SITE FOR RESIDUE NAD C 1118
source : AC3

69) chain C
residue 74
type
ligand
sequence A
description BINDING SITE FOR RESIDUE NAD C 1118
source : AC3

70) chain C
residue 75
type
ligand
sequence A
description BINDING SITE FOR RESIDUE NAD C 1118
source : AC3

71) chain C
residue 77
type
ligand
sequence A
description BINDING SITE FOR RESIDUE NAD C 1118
source : AC3

72) chain C
residue 92
type
ligand
sequence V
description BINDING SITE FOR RESIDUE NAD C 1118
source : AC3

73) chain C
residue 115
type
ligand
sequence A
description BINDING SITE FOR RESIDUE NAD C 1118
source : AC3

74) chain C
residue 116
type
ligand
sequence S
description BINDING SITE FOR RESIDUE NAD C 1118
source : AC3

75) chain C
residue 143
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE NAD C 1118
source : AC3

76) chain C
residue 147
type
ligand
sequence K
description BINDING SITE FOR RESIDUE NAD C 1118
source : AC3

77) chain C
residue 171
type
ligand
sequence G
description BINDING SITE FOR RESIDUE NAD C 1118
source : AC3

78) chain C
residue 173
type
ligand
sequence V
description BINDING SITE FOR RESIDUE NAD C 1118
source : AC3

79) chain C
residue 183
type
ligand
sequence E
description BINDING SITE FOR RESIDUE NAD C 1118
source : AC3

80) chain C
residue 184
type
ligand
sequence A
description BINDING SITE FOR RESIDUE NAD C 1118
source : AC3

81) chain D
residue 7
type
ligand
sequence G
description BINDING SITE FOR RESIDUE NAD D 1118
source : AC4

82) chain D
residue 9
type
ligand
sequence A
description BINDING SITE FOR RESIDUE NAD D 1118
source : AC4

83) chain D
residue 10
type
ligand
sequence G
description BINDING SITE FOR RESIDUE NAD D 1118
source : AC4

84) chain D
residue 11
type
ligand
sequence F
description BINDING SITE FOR RESIDUE NAD D 1118
source : AC4

85) chain D
residue 12
type
ligand
sequence I
description BINDING SITE FOR RESIDUE NAD D 1118
source : AC4

86) chain D
residue 31
type
ligand
sequence D
description BINDING SITE FOR RESIDUE NAD D 1118
source : AC4

87) chain D
residue 32
type
ligand
sequence N
description BINDING SITE FOR RESIDUE NAD D 1118
source : AC4

88) chain D
residue 33
type
ligand
sequence L
description BINDING SITE FOR RESIDUE NAD D 1118
source : AC4

89) chain D
residue 34
type
ligand
sequence A
description BINDING SITE FOR RESIDUE NAD D 1118
source : AC4

90) chain D
residue 35
type
ligand
sequence T
description BINDING SITE FOR RESIDUE NAD D 1118
source : AC4

91) chain D
residue 36
type
ligand
sequence G
description BINDING SITE FOR RESIDUE NAD D 1118
source : AC4

92) chain D
residue 50
type
ligand
sequence V
description BINDING SITE FOR RESIDUE NAD D 1118
source : AC4

93) chain D
residue 51
type
ligand
sequence D
description BINDING SITE FOR RESIDUE NAD D 1118
source : AC4

94) chain D
residue 52
type
ligand
sequence L
description BINDING SITE FOR RESIDUE NAD D 1118
source : AC4

95) chain D
residue 73
type
ligand
sequence Q
description BINDING SITE FOR RESIDUE NAD D 1118
source : AC4

96) chain D
residue 74
type
ligand
sequence A
description BINDING SITE FOR RESIDUE NAD D 1118
source : AC4

97) chain D
residue 75
type
ligand
sequence A
description BINDING SITE FOR RESIDUE NAD D 1118
source : AC4

98) chain D
residue 77
type
ligand
sequence A
description BINDING SITE FOR RESIDUE NAD D 1118
source : AC4

99) chain D
residue 92
type
ligand
sequence V
description BINDING SITE FOR RESIDUE NAD D 1118
source : AC4

100) chain D
residue 115
type
ligand
sequence A
description BINDING SITE FOR RESIDUE NAD D 1118
source : AC4

101) chain D
residue 116
type
ligand
sequence S
description BINDING SITE FOR RESIDUE NAD D 1118
source : AC4

102) chain D
residue 143
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE NAD D 1118
source : AC4

103) chain D
residue 147
type
ligand
sequence K
description BINDING SITE FOR RESIDUE NAD D 1118
source : AC4

104) chain D
residue 170
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE NAD D 1118
source : AC4

105) chain D
residue 171
type
ligand
sequence G
description BINDING SITE FOR RESIDUE NAD D 1118
source : AC4

106) chain D
residue 173
type
ligand
sequence V
description BINDING SITE FOR RESIDUE NAD D 1118
source : AC4

107) chain D
residue 179
type
ligand
sequence D
description BINDING SITE FOR RESIDUE NAD D 1118
source : AC4

108) chain D
residue 183
type
ligand
sequence E
description BINDING SITE FOR RESIDUE NAD D 1118
source : AC4

109) chain D
residue 184
type
ligand
sequence A
description BINDING SITE FOR RESIDUE NAD D 1118
source : AC4

110) chain A
residue 73
type BINDING
ligand
sequence Q
description NAD; via carbonyl oxygen. {ECO:0000213|PDB:2P5U, ECO:0000213|PDB: 2P5Y}.
source Swiss-Prot : SWS_FT_FI1

111) chain A
residue 143
type BINDING
ligand
sequence Y
description NAD. {ECO:0000213|PDB:2P5U, ECO:0000213|PDB:2P5Y}.
source Swiss-Prot : SWS_FT_FI2

112) chain A
residue 147
type BINDING
ligand
sequence K
description NAD. {ECO:0000213|PDB:2P5U, ECO:0000213|PDB:2P5Y}.
source Swiss-Prot : SWS_FT_FI2

113) chain A
residue 173
type BINDING
ligand
sequence V
description NAD; via amide nitrogen. {ECO:0000213|PDB:2P5U, ECO:0000213|PDB: 2P5Y}.
source Swiss-Prot : SWS_FT_FI3

114) chain A
residue 10-12
type NP_BIND
ligand
sequence GFI
description NAD. {ECO:0000213|PDB:2P5U, ECO:0000213|PDB:2P5Y}.
source Swiss-Prot : SWS_FT_FI4

115) chain A
residue 31-36
type NP_BIND
ligand
sequence DNLATG
description NAD. {ECO:0000213|PDB:2P5U, ECO:0000213|PDB:2P5Y}.
source Swiss-Prot : SWS_FT_FI4

116) chain A
residue 51-52
type NP_BIND
ligand
sequence DL
description NAD. {ECO:0000213|PDB:2P5U, ECO:0000213|PDB:2P5Y}.
source Swiss-Prot : SWS_FT_FI4

117) chain A
residue 183-184
type NP_BIND
ligand
sequence EA
description NAD. {ECO:0000213|PDB:2P5U}.
source Swiss-Prot : SWS_FT_FI5

118) chain B
residue 73
type BINDING
ligand
sequence Q
description NAD; via carbonyl oxygen. {ECO:0000213|PDB:2P5U, ECO:0000213|PDB: 2P5Y}.
source Swiss-Prot : SWS_FT_FI6

119) chain B
residue 143
type BINDING
ligand
sequence Y
description NAD. {ECO:0000213|PDB:2P5U, ECO:0000213|PDB:2P5Y}.
source Swiss-Prot : SWS_FT_FI7

120) chain B
residue 147
type BINDING
ligand
sequence K
description NAD. {ECO:0000213|PDB:2P5U, ECO:0000213|PDB:2P5Y}.
source Swiss-Prot : SWS_FT_FI7

121) chain B
residue 173
type BINDING
ligand
sequence V
description NAD; via amide nitrogen. {ECO:0000213|PDB:2P5U, ECO:0000213|PDB: 2P5Y}.
source Swiss-Prot : SWS_FT_FI8

122) chain B
residue 10-12
type NP_BIND
ligand
sequence GFI
description NAD. {ECO:0000213|PDB:2P5U, ECO:0000213|PDB:2P5Y}.
source Swiss-Prot : SWS_FT_FI9

123) chain B
residue 31-36
type NP_BIND
ligand
sequence DNLATG
description NAD. {ECO:0000213|PDB:2P5U, ECO:0000213|PDB:2P5Y}.
source Swiss-Prot : SWS_FT_FI9

124) chain B
residue 51-52
type NP_BIND
ligand
sequence DL
description NAD. {ECO:0000213|PDB:2P5U, ECO:0000213|PDB:2P5Y}.
source Swiss-Prot : SWS_FT_FI9

125) chain B
residue 183-184
type NP_BIND
ligand
sequence EA
description NAD. {ECO:0000213|PDB:2P5U}.
source Swiss-Prot : SWS_FT_FI10

126) chain C
residue 73
type BINDING
ligand
sequence Q
description NAD; via carbonyl oxygen. {ECO:0000213|PDB:2P5U, ECO:0000213|PDB: 2P5Y}.
source Swiss-Prot : SWS_FT_FI11

127) chain C
residue 143
type BINDING
ligand
sequence Y
description NAD. {ECO:0000213|PDB:2P5U, ECO:0000213|PDB:2P5Y}.
source Swiss-Prot : SWS_FT_FI12

128) chain C
residue 147
type BINDING
ligand
sequence K
description NAD. {ECO:0000213|PDB:2P5U, ECO:0000213|PDB:2P5Y}.
source Swiss-Prot : SWS_FT_FI12

129) chain C
residue 173
type BINDING
ligand
sequence V
description NAD; via amide nitrogen. {ECO:0000213|PDB:2P5U, ECO:0000213|PDB: 2P5Y}.
source Swiss-Prot : SWS_FT_FI13

130) chain C
residue 10-12
type NP_BIND
ligand
sequence GFI
description NAD. {ECO:0000213|PDB:2P5U, ECO:0000213|PDB:2P5Y}.
source Swiss-Prot : SWS_FT_FI14

131) chain C
residue 31-36
type NP_BIND
ligand
sequence DNLATG
description NAD. {ECO:0000213|PDB:2P5U, ECO:0000213|PDB:2P5Y}.
source Swiss-Prot : SWS_FT_FI14

132) chain C
residue 51-52
type NP_BIND
ligand
sequence DL
description NAD. {ECO:0000213|PDB:2P5U, ECO:0000213|PDB:2P5Y}.
source Swiss-Prot : SWS_FT_FI14

133) chain C
residue 183-184
type NP_BIND
ligand
sequence EA
description NAD. {ECO:0000213|PDB:2P5U}.
source Swiss-Prot : SWS_FT_FI15

134) chain D
residue 73
type BINDING
ligand
sequence Q
description NAD; via carbonyl oxygen. {ECO:0000213|PDB:2P5U, ECO:0000213|PDB: 2P5Y}.
source Swiss-Prot : SWS_FT_FI16

135) chain D
residue 143
type BINDING
ligand
sequence Y
description NAD. {ECO:0000213|PDB:2P5U, ECO:0000213|PDB:2P5Y}.
source Swiss-Prot : SWS_FT_FI17

136) chain D
residue 147
type BINDING
ligand
sequence K
description NAD. {ECO:0000213|PDB:2P5U, ECO:0000213|PDB:2P5Y}.
source Swiss-Prot : SWS_FT_FI17

137) chain D
residue 173
type BINDING
ligand
sequence V
description NAD; via amide nitrogen. {ECO:0000213|PDB:2P5U, ECO:0000213|PDB: 2P5Y}.
source Swiss-Prot : SWS_FT_FI18

138) chain D
residue 10-12
type NP_BIND
ligand
sequence GFI
description NAD. {ECO:0000213|PDB:2P5U, ECO:0000213|PDB:2P5Y}.
source Swiss-Prot : SWS_FT_FI19

139) chain D
residue 31-36
type NP_BIND
ligand
sequence DNLATG
description NAD. {ECO:0000213|PDB:2P5U, ECO:0000213|PDB:2P5Y}.
source Swiss-Prot : SWS_FT_FI19

140) chain D
residue 51-52
type NP_BIND
ligand
sequence DL
description NAD. {ECO:0000213|PDB:2P5U, ECO:0000213|PDB:2P5Y}.
source Swiss-Prot : SWS_FT_FI19

141) chain D
residue 183-184
type NP_BIND
ligand
sequence EA
description NAD. {ECO:0000213|PDB:2P5U}.
source Swiss-Prot : SWS_FT_FI20

142) chain A
residue 117
type catalytic
ligand
sequence T
description Annotated By Reference To The Literature 1eq2
source CSA : CSA1

143) chain A
residue 143
type catalytic
ligand
sequence Y
description Annotated By Reference To The Literature 1eq2
source CSA : CSA1

144) chain A
residue 147
type catalytic
ligand
sequence K
description Annotated By Reference To The Literature 1eq2
source CSA : CSA1

145) chain B
residue 117
type catalytic
ligand
sequence T
description Annotated By Reference To The Literature 1eq2
source CSA : CSA2

146) chain B
residue 143
type catalytic
ligand
sequence Y
description Annotated By Reference To The Literature 1eq2
source CSA : CSA2

147) chain B
residue 147
type catalytic
ligand
sequence K
description Annotated By Reference To The Literature 1eq2
source CSA : CSA2

148) chain C
residue 117
type catalytic
ligand
sequence T
description Annotated By Reference To The Literature 1eq2
source CSA : CSA3

149) chain C
residue 143
type catalytic
ligand
sequence Y
description Annotated By Reference To The Literature 1eq2
source CSA : CSA3

150) chain C
residue 147
type catalytic
ligand
sequence K
description Annotated By Reference To The Literature 1eq2
source CSA : CSA3

151) chain D
residue 117
type catalytic
ligand
sequence T
description Annotated By Reference To The Literature 1eq2
source CSA : CSA4

152) chain D
residue 143
type catalytic
ligand
sequence Y
description Annotated By Reference To The Literature 1eq2
source CSA : CSA4

153) chain D
residue 147
type catalytic
ligand
sequence K
description Annotated By Reference To The Literature 1eq2
source CSA : CSA4

154) chain A
residue 143
type catalytic
ligand
sequence Y
description Annotated By Reference To The Literature 1eq2
source CSA : CSA5

155) chain A
residue 147
type catalytic
ligand
sequence K
description Annotated By Reference To The Literature 1eq2
source CSA : CSA5

156) chain B
residue 143
type catalytic
ligand
sequence Y
description Annotated By Reference To The Literature 1eq2
source CSA : CSA6

157) chain B
residue 147
type catalytic
ligand
sequence K
description Annotated By Reference To The Literature 1eq2
source CSA : CSA6

158) chain C
residue 143
type catalytic
ligand
sequence Y
description Annotated By Reference To The Literature 1eq2
source CSA : CSA7

159) chain C
residue 147
type catalytic
ligand
sequence K
description Annotated By Reference To The Literature 1eq2
source CSA : CSA7

160) chain D
residue 143
type catalytic
ligand
sequence Y
description Annotated By Reference To The Literature 1eq2
source CSA : CSA8

161) chain D
residue 147
type catalytic
ligand
sequence K
description Annotated By Reference To The Literature 1eq2
source CSA : CSA8


Display surface

Download
Links