eF-site ID 2p3m_8-A
PDB Code 2p3m
Model 8
Chain A

click to enlarge
Title Solution structure of Mj0056
Classification TRANSFERASE
Compound Riboflavin Kinase MJ0056
Source Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) (Y056_METJA)
Sequence A:  MVKLMIIEGEVVSGLGEGRYFLSLPPYKEIFKKILGFEPY
EGTLNLKLDREFDINKFKYIETEDFEFNGKRFFGVKVLPI
KILIGNKKIDGAIVVPKKTYHSSEIIEIIAPMKLREQFNL
KDGDVIKILIKGDKDE
Description (1)  Riboflavin Kinase MJ0056


Functional site

1) chain A
residue 43
type METAL
ligand
sequence T
description Magnesium
source Swiss-Prot : SWS_FT_FI1

2) chain A
residue 45
type METAL
ligand
sequence N
description Magnesium
source Swiss-Prot : SWS_FT_FI1

3) chain A
residue 99
type BINDING
ligand
sequence T
description FMN.
source Swiss-Prot : SWS_FT_FI2

4) chain A
residue 100
type BINDING
ligand
sequence Y
description FMN.
source Swiss-Prot : SWS_FT_FI2

5) chain A
residue 107
type BINDING
ligand
sequence E
description FMN.
source Swiss-Prot : SWS_FT_FI2

6) chain A
residue 14-19
type NP_BIND
ligand
sequence GLGEGR
description CDP.
source Swiss-Prot : SWS_FT_FI3

7) chain A
residue 112-115
type NP_BIND
ligand
sequence MKLR
description CDP.
source Swiss-Prot : SWS_FT_FI3


Display surface

Download
Links