eF-site ID 2oy0-AB
PDB Code 2oy0
Chain A, B

click to enlarge
Title Crystal structure of the West Nile virus methyltransferase
Classification VIRAL PROTEIN
Compound Methyltransferase
Source West Nile virus (WNV) (Q9Q6P4_WNV)
Sequence A:  RTLGEVWKERLNQMTKEEFTRYRKEAIIEVDRSAAKHARK
EGNVTGGHPVSRGTAKLRWLVERRFLEPVGKVIDLGCGRG
GWCYYMATQKRVQEVRGYTKGGPGHEEPQLVQSYGWNIVT
MKSGVDVFYRPSECCDTLLCDIGESSSSAEVEEHRTIRVL
EMVEDWLHRGPREFCVKVLCPYMPKVIEKMELLQRRYGGG
LVRNPLSRNSTHEMYWVSRASGNVVHSVNMTSQVLLGRME
KRTWKGPQYEEDVNLGSGTRAV
B:  RTLGEVWKERLNQMTKEEFTRYRKEAIIEVDRSAAKHARK
EGNVTGGHPVSRGTAKLRWLVERRFLEPVGKVIDLGCGRG
GWCYYMATQKRVQEVRGYTKGGPGHEEPQLVQSYGWNIVT
MKSGVDVFYRPSECCDTLLCDIGESSSSAEVEEHRTIRVL
EMVEDWLHRGPREFCVKVLCPYMPKVIEKMELLQRRYGGG
LVRNPLSRNSTHEMYWVSRASGNVVHSVNMTSQVLLGRME
KRTWKGPQYEEDVNLGSGTRAV
Description (1)  Methyltransferase


Functional site

1) chain A
residue 56
type
ligand
sequence S
description BINDING SITE FOR RESIDUE SAH A 301
source : AC1

2) chain A
residue 58
type
ligand
sequence G
description BINDING SITE FOR RESIDUE SAH A 301
source : AC1

3) chain A
residue 81
type
ligand
sequence G
description BINDING SITE FOR RESIDUE SAH A 301
source : AC1

4) chain A
residue 82
type
ligand
sequence C
description BINDING SITE FOR RESIDUE SAH A 301
source : AC1

5) chain A
residue 83
type
ligand
sequence G
description BINDING SITE FOR RESIDUE SAH A 301
source : AC1

6) chain A
residue 84
type
ligand
sequence R
description BINDING SITE FOR RESIDUE SAH A 301
source : AC1

7) chain A
residue 85
type
ligand
sequence G
description BINDING SITE FOR RESIDUE SAH A 301
source : AC1

8) chain A
residue 86
type
ligand
sequence G
description BINDING SITE FOR RESIDUE SAH A 301
source : AC1

9) chain A
residue 87
type
ligand
sequence W
description BINDING SITE FOR RESIDUE SAH A 301
source : AC1

10) chain A
residue 104
type
ligand
sequence T
description BINDING SITE FOR RESIDUE SAH A 301
source : AC1

11) chain A
residue 105
type
ligand
sequence K
description BINDING SITE FOR RESIDUE SAH A 301
source : AC1

12) chain A
residue 110
type
ligand
sequence H
description BINDING SITE FOR RESIDUE SAH A 301
source : AC1

13) chain A
residue 111
type
ligand
sequence E
description BINDING SITE FOR RESIDUE SAH A 301
source : AC1

14) chain A
residue 131
type
ligand
sequence D
description BINDING SITE FOR RESIDUE SAH A 301
source : AC1

15) chain A
residue 132
type
ligand
sequence V
description BINDING SITE FOR RESIDUE SAH A 301
source : AC1

16) chain A
residue 133
type
ligand
sequence F
description BINDING SITE FOR RESIDUE SAH A 301
source : AC1

17) chain A
residue 146
type
ligand
sequence D
description BINDING SITE FOR RESIDUE SAH A 301
source : AC1

18) chain A
residue 149
type
ligand
sequence E
description BINDING SITE FOR RESIDUE SAH A 301
source : AC1

19) chain B
residue 200
type
ligand
sequence R
description BINDING SITE FOR RESIDUE SAH A 301
source : AC1

20) chain B
residue 56
type
ligand
sequence S
description BINDING SITE FOR RESIDUE SAH B 302
source : AC2

21) chain B
residue 58
type
ligand
sequence G
description BINDING SITE FOR RESIDUE SAH B 302
source : AC2

22) chain B
residue 81
type
ligand
sequence G
description BINDING SITE FOR RESIDUE SAH B 302
source : AC2

23) chain B
residue 82
type
ligand
sequence C
description BINDING SITE FOR RESIDUE SAH B 302
source : AC2

24) chain B
residue 83
type
ligand
sequence G
description BINDING SITE FOR RESIDUE SAH B 302
source : AC2

25) chain B
residue 86
type
ligand
sequence G
description BINDING SITE FOR RESIDUE SAH B 302
source : AC2

26) chain B
residue 87
type
ligand
sequence W
description BINDING SITE FOR RESIDUE SAH B 302
source : AC2

27) chain B
residue 104
type
ligand
sequence T
description BINDING SITE FOR RESIDUE SAH B 302
source : AC2

28) chain B
residue 105
type
ligand
sequence K
description BINDING SITE FOR RESIDUE SAH B 302
source : AC2

29) chain B
residue 110
type
ligand
sequence H
description BINDING SITE FOR RESIDUE SAH B 302
source : AC2

30) chain B
residue 111
type
ligand
sequence E
description BINDING SITE FOR RESIDUE SAH B 302
source : AC2

31) chain B
residue 131
type
ligand
sequence D
description BINDING SITE FOR RESIDUE SAH B 302
source : AC2

32) chain B
residue 132
type
ligand
sequence V
description BINDING SITE FOR RESIDUE SAH B 302
source : AC2

33) chain B
residue 133
type
ligand
sequence F
description BINDING SITE FOR RESIDUE SAH B 302
source : AC2

34) chain B
residue 146
type
ligand
sequence D
description BINDING SITE FOR RESIDUE SAH B 302
source : AC2

35) chain B
residue 147
type
ligand
sequence I
description BINDING SITE FOR RESIDUE SAH B 302
source : AC2


Display surface

Download
Links