eF-site ID 2orl_5-A
PDB Code 2orl
Model 5
Chain A

click to enlarge
Title Solution structure of the cytochrome c- para-aminophenol adduct
Classification ELECTRON TRANSPORT
Compound Cytochrome c iso-1
Source Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (CYC1_YEAST)
Sequence A:  TEFKAGSAKKGATLFKTRCLQCHTVEKGGPHKVGPNLHGI
FGRHSGQAEGYSYTDANIKKNVLWDENNMSEYLTNPKKYI
PGTKMAFGGLKKEKDRNDLITYLKKATE
Description (1)  Cytochrome c iso-1


Functional site

1) chain A
residue 13
type
ligand
sequence R
description BINDING SITE FOR RESIDUE HEC A 104
source : AC1

2) chain A
residue 14
type
ligand
sequence C
description BINDING SITE FOR RESIDUE HEC A 104
source : AC1

3) chain A
residue 16
type
ligand
sequence Q
description BINDING SITE FOR RESIDUE HEC A 104
source : AC1

4) chain A
residue 17
type
ligand
sequence C
description BINDING SITE FOR RESIDUE HEC A 104
source : AC1

5) chain A
residue 18
type
ligand
sequence H
description BINDING SITE FOR RESIDUE HEC A 104
source : AC1

6) chain A
residue 28
type
ligand
sequence V
description BINDING SITE FOR RESIDUE HEC A 104
source : AC1

7) chain A
residue 30
type
ligand
sequence P
description BINDING SITE FOR RESIDUE HEC A 104
source : AC1

8) chain A
residue 32
type
ligand
sequence L
description BINDING SITE FOR RESIDUE HEC A 104
source : AC1

9) chain A
residue 35
type
ligand
sequence I
description BINDING SITE FOR RESIDUE HEC A 104
source : AC1

10) chain A
residue 40
type
ligand
sequence S
description BINDING SITE FOR RESIDUE HEC A 104
source : AC1

11) chain A
residue 41
type
ligand
sequence G
description BINDING SITE FOR RESIDUE HEC A 104
source : AC1

12) chain A
residue 42
type
ligand
sequence Q
description BINDING SITE FOR RESIDUE HEC A 104
source : AC1

13) chain A
residue 46
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE HEC A 104
source : AC1

14) chain A
residue 48
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE HEC A 104
source : AC1

15) chain A
residue 49
type
ligand
sequence T
description BINDING SITE FOR RESIDUE HEC A 104
source : AC1

16) chain A
residue 52
type
ligand
sequence N
description BINDING SITE FOR RESIDUE HEC A 104
source : AC1

17) chain A
residue 59
type
ligand
sequence W
description BINDING SITE FOR RESIDUE HEC A 104
source : AC1

18) chain A
residue 68
type
ligand
sequence L
description BINDING SITE FOR RESIDUE HEC A 104
source : AC1

19) chain A
residue 78
type
ligand
sequence T
description BINDING SITE FOR RESIDUE HEC A 104
source : AC1

20) chain A
residue 79
type
ligand
sequence K
description BINDING SITE FOR RESIDUE HEC A 104
source : AC1

21) chain A
residue 80
type
ligand
sequence M
description BINDING SITE FOR RESIDUE HEC A 104
source : AC1

22) chain A
residue 82
type
ligand
sequence F
description BINDING SITE FOR RESIDUE HEC A 104
source : AC1

23) chain A
residue 36
type
ligand
sequence F
description BINDING SITE FOR RESIDUE 4NL A 105
source : AC2

24) chain A
residue 60
type
ligand
sequence D
description BINDING SITE FOR RESIDUE 4NL A 105
source : AC2

25) chain A
residue 61
type
ligand
sequence E
description BINDING SITE FOR RESIDUE 4NL A 105
source : AC2

26) chain A
residue 99
type
ligand
sequence K
description BINDING SITE FOR RESIDUE 4NL A 105
source : AC2

27) chain A
residue 103
type
ligand
sequence E
description BINDING SITE FOR RESIDUE 4NL A 105
source : AC2

28) chain A
residue 23
type METAL
ligand
sequence G
description Iron (heme axial ligand)
source Swiss-Prot : SWS_FT_FI1

29) chain A
residue 85
type METAL
ligand
sequence L
description Iron (heme axial ligand)
source Swiss-Prot : SWS_FT_FI1

30) chain A
residue 19
type BINDING
ligand
sequence T
description Heme (covalent).
source Swiss-Prot : SWS_FT_FI2

31) chain A
residue 22
type BINDING
ligand
sequence K
description Heme (covalent).
source Swiss-Prot : SWS_FT_FI2

32) chain A
residue 10
type binding
ligand HEC: HEME C
sequence F
description HEME C binding site
source pdb_hetatom : HEC_2orl_A_104

33) chain A
residue 13-18
type binding
ligand HEC: HEME C
sequence RCLQCH
description HEME C binding site
source pdb_hetatom : HEC_2orl_A_104

34) chain A
residue 28-32
type binding
ligand HEC: HEME C
sequence VGPNL
description HEME C binding site
source pdb_hetatom : HEC_2orl_A_104

35) chain A
residue 35
type binding
ligand HEC: HEME C
sequence I
description HEME C binding site
source pdb_hetatom : HEC_2orl_A_104

36) chain A
residue 39-43
type binding
ligand HEC: HEME C
sequence HSGQA
description HEME C binding site
source pdb_hetatom : HEC_2orl_A_104

37) chain A
residue 46-49
type binding
ligand HEC: HEME C
sequence YSYT
description HEME C binding site
source pdb_hetatom : HEC_2orl_A_104

38) chain A
residue 52
type binding
ligand HEC: HEME C
sequence N
description HEME C binding site
source pdb_hetatom : HEC_2orl_A_104

39) chain A
residue 59
type binding
ligand HEC: HEME C
sequence W
description HEME C binding site
source pdb_hetatom : HEC_2orl_A_104

40) chain A
residue 64
type binding
ligand HEC: HEME C
sequence M
description HEME C binding site
source pdb_hetatom : HEC_2orl_A_104

41) chain A
residue 67-68
type binding
ligand HEC: HEME C
sequence YL
description HEME C binding site
source pdb_hetatom : HEC_2orl_A_104

42) chain A
residue 75
type binding
ligand HEC: HEME C
sequence I
description HEME C binding site
source pdb_hetatom : HEC_2orl_A_104

43) chain A
residue 77-82
type binding
ligand HEC: HEME C
sequence GTKMAF
description HEME C binding site
source pdb_hetatom : HEC_2orl_A_104

44) chain A
residue 84-85
type binding
ligand HEC: HEME C
sequence GL
description HEME C binding site
source pdb_hetatom : HEC_2orl_A_104

45) chain A
residue 94
type binding
ligand HEC: HEME C
sequence L
description HEME C binding site
source pdb_hetatom : HEC_2orl_A_104

46) chain A
residue 98
type binding
ligand HEC: HEME C
sequence L
description HEME C binding site
source pdb_hetatom : HEC_2orl_A_104

47) chain A
residue 9
type binding
ligand HEC: HEME C
sequence L
description HEME C binding site
source pdb_hetatom : HEC_2orl_A_104

48) chain A
residue 38
type binding
ligand HEC: HEME C
sequence R
description HEME C binding site
source pdb_hetatom : HEC_2orl_A_104

49) chain A
residue 36-38
type binding
ligand 4NL: 4-AMINOPHENOL
sequence FGR
description 4-AMINOPHENOL binding site
source pdb_hetatom : 4NL_2orl_A_105

50) chain A
residue 58-62
type binding
ligand 4NL: 4-AMINOPHENOL
sequence LWDEN
description 4-AMINOPHENOL binding site
source pdb_hetatom : 4NL_2orl_A_105

51) chain A
residue 95
type binding
ligand 4NL: 4-AMINOPHENOL
sequence I
description 4-AMINOPHENOL binding site
source pdb_hetatom : 4NL_2orl_A_105

52) chain A
residue 98-99
type binding
ligand 4NL: 4-AMINOPHENOL
sequence LK
description 4-AMINOPHENOL binding site
source pdb_hetatom : 4NL_2orl_A_105

53) chain A
residue 102-103
type binding
ligand 4NL: 4-AMINOPHENOL
sequence TE
description 4-AMINOPHENOL binding site
source pdb_hetatom : 4NL_2orl_A_105

54) chain A
residue 64
type binding
ligand 4NL: 4-AMINOPHENOL
sequence M
description 4-AMINOPHENOL binding site
source pdb_hetatom : 4NL_2orl_A_105

55) chain A
residue 100
type binding
ligand 4NL: 4-AMINOPHENOL
sequence K
description 4-AMINOPHENOL binding site
source pdb_hetatom : 4NL_2orl_A_105


Display surface

Download
Links