eF-site ID 2or2-AB
PDB Code 2or2
Chain A, B

click to enlarge
Title Structure of the W47A/W242A Mutant of Bacterial Phosphatidylinositol-Specific Phospholipase C
Classification LYASE
Compound 1-phosphatidylinositol phosphodiesterase
Source Bacillus thuringiensis (PLC_BACTU)
Sequence A:  ASSVNELENWSKWMQPIPDNIPLARISIPGTHDSGTFKLQ
NPIKQVAGMTQEYDFRYQMDHGARIFDIRGRLTDDNTIVL
HHGPLYLYVTLHEFINEAKQFLKDNPSETIIMSLKKEYED
MKGAEGSFSSTFEKNYFVDPIFLKTEGNIKLGDARGKIVL
LKRYSGSNESGGYNNFYWPDNETFTTTVNQNVNVTVQDKY
KVNYDEKVKSIKDTMDETMNNSEDLNHLYINFTSLSSGGT
AANSPYYYASYINPEIANDIKQKNPTRVGWVIQDYINEKW
SPLLYQEVIRANKSLI
B:  ASSVNELENWSKWMQPIPDNIPLARISIPGTHDSGTFKLQ
NPIKQVAGMTQEYDFRYQMDHGARIFDIRGRLTDDNTIVL
HHGPLYLYVTLHEFINEAKQFLKDNPSETIIMSLKKEYED
MKGAEGSFSSTFEKNYFVDPIFLKTEGNIKLGDARGKIVL
LKRYSGSNESGGYNNFYWPDNETFTTTVNQNVNVTVQDKY
KVNYDEKVKSIKDTMDETMNNSEDLNHLYINFTSLSSGGT
AANSPYYYASYINPEIANDIKQKNPTRVGWVIQDYINEKW
SPLLYQEVIRANKSLI
Description (1)  1-phosphatidylinositol phosphodiesterase (E.C.4.6.1.13)


Functional site

1) chain A
residue 82
type ACT_SITE
ligand
sequence H
description Proton donor. {ECO:0000255|PROSITE- ProRule:PRU00270}.
source Swiss-Prot : SWS_FT_FI1

2) chain A
residue 32
type ACT_SITE
ligand
sequence H
description Proton acceptor. {ECO:0000255|PROSITE- ProRule:PRU00270}.
source Swiss-Prot : SWS_FT_FI2

3) chain B
residue 82
type ACT_SITE
ligand
sequence H
description Proton donor. {ECO:0000255|PROSITE- ProRule:PRU00270}.
source Swiss-Prot : SWS_FT_FI3

4) chain B
residue 32
type ACT_SITE
ligand
sequence H
description Proton acceptor. {ECO:0000255|PROSITE- ProRule:PRU00270}.
source Swiss-Prot : SWS_FT_FI4

5) chain A
residue 274
type catalytic
ligand
sequence D
description Annotated By Reference To The Literature 2plc
source CSA : CSA1

6) chain A
residue 32
type catalytic
ligand
sequence H
description Annotated By Reference To The Literature 2plc
source CSA : CSA1

7) chain A
residue 33
type catalytic
ligand
sequence D
description Annotated By Reference To The Literature 2plc
source CSA : CSA1

8) chain A
residue 69
type catalytic
ligand
sequence R
description Annotated By Reference To The Literature 2plc
source CSA : CSA1

9) chain A
residue 82
type catalytic
ligand
sequence H
description Annotated By Reference To The Literature 2plc
source CSA : CSA1

10) chain B
residue 274
type catalytic
ligand
sequence D
description Annotated By Reference To The Literature 2plc
source CSA : CSA2

11) chain B
residue 32
type catalytic
ligand
sequence H
description Annotated By Reference To The Literature 2plc
source CSA : CSA2

12) chain B
residue 33
type catalytic
ligand
sequence D
description Annotated By Reference To The Literature 2plc
source CSA : CSA2

13) chain B
residue 69
type catalytic
ligand
sequence R
description Annotated By Reference To The Literature 2plc
source CSA : CSA2

14) chain B
residue 82
type catalytic
ligand
sequence H
description Annotated By Reference To The Literature 2plc
source CSA : CSA2


Display surface

Download
Links