|
|
eF-site ID
|
2or2-A |
|
PDB Code
|
2or2 |
|
Chain
|
A |
|
click to enlarge
|
|
|
Title
|
Structure of the W47A/W242A Mutant of Bacterial Phosphatidylinositol-Specific Phospholipase C |
|
Classification
|
LYASE |
|
Compound
|
1-phosphatidylinositol phosphodiesterase |
|
Source
|
Bacillus thuringiensis (PLC_BACTU) |
|
|
Sequence
|
A: |
ASSVNELENWSKWMQPIPDNIPLARISIPGTHDSGTFKLQ
NPIKQVAGMTQEYDFRYQMDHGARIFDIRGRLTDDNTIVL
HHGPLYLYVTLHEFINEAKQFLKDNPSETIIMSLKKEYED
MKGAEGSFSSTFEKNYFVDPIFLKTEGNIKLGDARGKIVL
LKRYSGSNESGGYNNFYWPDNETFTTTVNQNVNVTVQDKY
KVNYDEKVKSIKDTMDETMNNSEDLNHLYINFTSLSSGGT
AANSPYYYASYINPEIANDIKQKNPTRVGWVIQDYINEKW
SPLLYQEVIRANKSLI
|
|
|
Description
|
|
Functional site
|
|
|
1)
|
chain |
A |
| residue |
274 |
| type |
catalytic |
| sequence |
D
|
| description |
Annotated By Reference To The Literature 2plc
|
| source |
CSA : CSA1
|
|
|
2)
|
chain |
A |
| residue |
32 |
| type |
catalytic |
| sequence |
H
|
| description |
Annotated By Reference To The Literature 2plc
|
| source |
CSA : CSA1
|
|
|
3)
|
chain |
A |
| residue |
33 |
| type |
catalytic |
| sequence |
D
|
| description |
Annotated By Reference To The Literature 2plc
|
| source |
CSA : CSA1
|
|
|
4)
|
chain |
A |
| residue |
69 |
| type |
catalytic |
| sequence |
R
|
| description |
Annotated By Reference To The Literature 2plc
|
| source |
CSA : CSA1
|
|
|
5)
|
chain |
A |
| residue |
82 |
| type |
catalytic |
| sequence |
H
|
| description |
Annotated By Reference To The Literature 2plc
|
| source |
CSA : CSA1
|
|
|
|