eF-site ID 2or2-A PDB Code 2or2 Chain A click to enlarge Title Structure of the W47A/W242A Mutant of Bacterial Phosphatidylinositol-Specific Phospholipase C Classification LYASE Compound 1-phosphatidylinositol phosphodiesterase Source Bacillus thuringiensis (PLC_BACTU) Sequence A:  ASSVNELENWSKWMQPIPDNIPLARISIPGTHDSGTFKLQ NPIKQVAGMTQEYDFRYQMDHGARIFDIRGRLTDDNTIVL HHGPLYLYVTLHEFINEAKQFLKDNPSETIIMSLKKEYED MKGAEGSFSSTFEKNYFVDPIFLKTEGNIKLGDARGKIVL LKRYSGSNESGGYNNFYWPDNETFTTTVNQNVNVTVQDKY KVNYDEKVKSIKDTMDETMNNSEDLNHLYINFTSLSSGGT AANSPYYYASYINPEIANDIKQKNPTRVGWVIQDYINEKW SPLLYQEVIRANKSLI Description (1)  1-phosphatidylinositol phosphodiesterase (E.C.4.6.1.13) Functional site 1) chain A residue 82 type ACT_SITE ligand sequence H description Proton donor. {ECO:0000255|PROSITE- ProRule:PRU00270}. source Swiss-Prot : SWS_FT_FI1 2) chain A residue 32 type ACT_SITE ligand sequence H description Proton acceptor. {ECO:0000255|PROSITE- ProRule:PRU00270}. source Swiss-Prot : SWS_FT_FI2 3) chain A residue 274 type catalytic ligand sequence D description Annotated By Reference To The Literature 2plc source CSA : CSA1 4) chain A residue 32 type catalytic ligand sequence H description Annotated By Reference To The Literature 2plc source CSA : CSA1 5) chain A residue 33 type catalytic ligand sequence D description Annotated By Reference To The Literature 2plc source CSA : CSA1 6) chain A residue 69 type catalytic ligand sequence R description Annotated By Reference To The Literature 2plc source CSA : CSA1 7) chain A residue 82 type catalytic ligand sequence H description Annotated By Reference To The Literature 2plc source CSA : CSA1

Display surface Download Links