eF-site ID 2omi-ABCDEFGHIJKL
PDB Code 2omi
Chain A, B, C, D, E, F, G, H, I, J, K, L

click to enlarge
Title Structure of human insulin cocrystallized with protamine
Classification HORMONE
Compound Insulin A chain
Source ORGANISM_COMMON: human; ORGANISM_SCIENTIFIC: Homo sapiens;
Sequence A:  GIVEQCCTSICSLYQLENYCN
B:  FVNQHLCGSHLVEALYLVCGERGFFYTPKT
C:  GIVEQCCTSICSLYQLENYCN
D:  FVNQHLCGSHLVEALYLVCGERGFFYTPK
E:  GIVEQCCTSICSLYQLENYCN
F:  FVNQHLCGSHLVEALYLVCGERGFFYTP
G:  GIVEQCCTSICSLYQLENYCN
H:  FVNQHLCGSHLVEALYLVCGERGFFYTP
I:  GIVEQCCTSICSLYQLENYCN
J:  FVNQHLCGSHLVEALYLVCGERGFFYTP
K:  GIVEQCCTSICSLYQLENYCN
L:  FVNQHLCGSHLVEALYLVCGERGFFYTP
Description (1)  Insulin A chain, Insulin B chain


Functional site

1) chain H
residue 10
type
ligand
sequence H
description BINDING SITE FOR RESIDUE ZN H 201
source : AC1

2) chain J
residue 10
type
ligand
sequence H
description BINDING SITE FOR RESIDUE ZN H 201
source : AC1

3) chain L
residue 10
type
ligand
sequence H
description BINDING SITE FOR RESIDUE ZN H 201
source : AC1

4) chain B
residue 10
type
ligand
sequence H
description BINDING SITE FOR RESIDUE ZN B 202
source : AC2

5) chain D
residue 10
type
ligand
sequence H
description BINDING SITE FOR RESIDUE ZN B 202
source : AC2

6) chain F
residue 10
type
ligand
sequence H
description BINDING SITE FOR RESIDUE ZN B 202
source : AC2

7) chain H
residue 10
type
ligand
sequence H
description BINDING SITE FOR RESIDUE CL J 401
source : AC3

8) chain J
residue 10
type
ligand
sequence H
description BINDING SITE FOR RESIDUE CL J 401
source : AC3

9) chain L
residue 10
type
ligand
sequence H
description BINDING SITE FOR RESIDUE CL J 401
source : AC3

10) chain B
residue 10
type
ligand
sequence H
description BINDING SITE FOR RESIDUE CL B 402
source : AC4

11) chain D
residue 10
type
ligand
sequence H
description BINDING SITE FOR RESIDUE CL B 402
source : AC4

12) chain F
residue 10
type
ligand
sequence H
description BINDING SITE FOR RESIDUE CL B 402
source : AC4

13) chain A
residue 6
type
ligand
sequence C
description BINDING SITE FOR RESIDUE RCO A 301
source : AC5

14) chain A
residue 9
type
ligand
sequence S
description BINDING SITE FOR RESIDUE RCO A 301
source : AC5

15) chain A
residue 10
type
ligand
sequence I
description BINDING SITE FOR RESIDUE RCO A 301
source : AC5

16) chain A
residue 11
type
ligand
sequence C
description BINDING SITE FOR RESIDUE RCO A 301
source : AC5

17) chain B
residue 11
type
ligand
sequence L
description BINDING SITE FOR RESIDUE RCO A 301
source : AC5

18) chain B
residue 14
type
ligand
sequence A
description BINDING SITE FOR RESIDUE RCO A 301
source : AC5

19) chain D
residue 5
type
ligand
sequence H
description BINDING SITE FOR RESIDUE RCO A 301
source : AC5

20) chain B
residue 17
type
ligand
sequence L
description BINDING SITE FOR RESIDUE RCO G 302
source : AC6

21) chain G
residue 6
type
ligand
sequence C
description BINDING SITE FOR RESIDUE RCO G 302
source : AC6

22) chain G
residue 9
type
ligand
sequence S
description BINDING SITE FOR RESIDUE RCO G 302
source : AC6

23) chain G
residue 10
type
ligand
sequence I
description BINDING SITE FOR RESIDUE RCO G 302
source : AC6

24) chain G
residue 11
type
ligand
sequence C
description BINDING SITE FOR RESIDUE RCO G 302
source : AC6

25) chain H
residue 11
type
ligand
sequence L
description BINDING SITE FOR RESIDUE RCO G 302
source : AC6

26) chain H
residue 14
type
ligand
sequence A
description BINDING SITE FOR RESIDUE RCO G 302
source : AC6

27) chain B
residue 5
type
ligand
sequence H
description BINDING SITE FOR RESIDUE RCO E 303
source : AC7

28) chain E
residue 6
type
ligand
sequence C
description BINDING SITE FOR RESIDUE RCO E 303
source : AC7

29) chain E
residue 9
type
ligand
sequence S
description BINDING SITE FOR RESIDUE RCO E 303
source : AC7

30) chain E
residue 10
type
ligand
sequence I
description BINDING SITE FOR RESIDUE RCO E 303
source : AC7

31) chain E
residue 11
type
ligand
sequence C
description BINDING SITE FOR RESIDUE RCO E 303
source : AC7

32) chain F
residue 10
type
ligand
sequence H
description BINDING SITE FOR RESIDUE RCO E 303
source : AC7

33) chain F
residue 11
type
ligand
sequence L
description BINDING SITE FOR RESIDUE RCO E 303
source : AC7

34) chain F
residue 14
type
ligand
sequence A
description BINDING SITE FOR RESIDUE RCO E 303
source : AC7

35) chain J
residue 17
type
ligand
sequence L
description BINDING SITE FOR RESIDUE RCO E 303
source : AC7

36) chain D
residue 17
type
ligand
sequence L
description BINDING SITE FOR RESIDUE RCO K 304
source : AC8

37) chain H
residue 5
type
ligand
sequence H
description BINDING SITE FOR RESIDUE RCO K 304
source : AC8

38) chain K
residue 6
type
ligand
sequence C
description BINDING SITE FOR RESIDUE RCO K 304
source : AC8

39) chain K
residue 9
type
ligand
sequence S
description BINDING SITE FOR RESIDUE RCO K 304
source : AC8

40) chain K
residue 10
type
ligand
sequence I
description BINDING SITE FOR RESIDUE RCO K 304
source : AC8

41) chain K
residue 11
type
ligand
sequence C
description BINDING SITE FOR RESIDUE RCO K 304
source : AC8

42) chain L
residue 11
type
ligand
sequence L
description BINDING SITE FOR RESIDUE RCO K 304
source : AC8

43) chain L
residue 14
type
ligand
sequence A
description BINDING SITE FOR RESIDUE RCO K 304
source : AC8

44) chain F
residue 17
type
ligand
sequence L
description BINDING SITE FOR RESIDUE RCO I 305
source : AC9

45) chain I
residue 6
type
ligand
sequence C
description BINDING SITE FOR RESIDUE RCO I 305
source : AC9

46) chain I
residue 10
type
ligand
sequence I
description BINDING SITE FOR RESIDUE RCO I 305
source : AC9

47) chain I
residue 11
type
ligand
sequence C
description BINDING SITE FOR RESIDUE RCO I 305
source : AC9

48) chain J
residue 11
type
ligand
sequence L
description BINDING SITE FOR RESIDUE RCO I 305
source : AC9

49) chain J
residue 14
type
ligand
sequence A
description BINDING SITE FOR RESIDUE RCO I 305
source : AC9

50) chain L
residue 5
type
ligand
sequence H
description BINDING SITE FOR RESIDUE RCO I 305
source : AC9

51) chain C
residue 6
type
ligand
sequence C
description BINDING SITE FOR RESIDUE RCO C 306
source : BC1

52) chain C
residue 10
type
ligand
sequence I
description BINDING SITE FOR RESIDUE RCO C 306
source : BC1

53) chain C
residue 11
type
ligand
sequence C
description BINDING SITE FOR RESIDUE RCO C 306
source : BC1

54) chain D
residue 14
type
ligand
sequence A
description BINDING SITE FOR RESIDUE RCO C 306
source : BC1

55) chain F
residue 5
type
ligand
sequence H
description BINDING SITE FOR RESIDUE RCO C 306
source : BC1

56) chain A
residue 6-7
type binding
ligand RCO: RESORCINOL
sequence CC
description RESORCINOL binding site
source pdb_hetatom : RCO_2omi_A_301

57) chain A
residue 9-11
type binding
ligand RCO: RESORCINOL
sequence SIC
description RESORCINOL binding site
source pdb_hetatom : RCO_2omi_A_301

58) chain A
residue 16
type binding
ligand RCO: RESORCINOL
sequence L
description RESORCINOL binding site
source pdb_hetatom : RCO_2omi_A_301

59) chain B
residue 7
type binding
ligand RCO: RESORCINOL
sequence C
description RESORCINOL binding site
source pdb_hetatom : RCO_2omi_A_301

60) chain B
residue 10-11
type binding
ligand RCO: RESORCINOL
sequence HL
description RESORCINOL binding site
source pdb_hetatom : RCO_2omi_A_301

61) chain B
residue 14
type binding
ligand RCO: RESORCINOL
sequence A
description RESORCINOL binding site
source pdb_hetatom : RCO_2omi_A_301

62) chain D
residue 2
type binding
ligand RCO: RESORCINOL
sequence V
description RESORCINOL binding site
source pdb_hetatom : RCO_2omi_A_301

63) chain D
residue 5-6
type binding
ligand RCO: RESORCINOL
sequence HL
description RESORCINOL binding site
source pdb_hetatom : RCO_2omi_A_301

64) chain H
residue 17
type binding
ligand RCO: RESORCINOL
sequence L
description RESORCINOL binding site
source pdb_hetatom : RCO_2omi_A_301

65) chain B
residue 2
type binding
ligand RCO: RESORCINOL
sequence V
description RESORCINOL binding site
source pdb_hetatom : RCO_2omi_E_303

66) chain B
residue 5-6
type binding
ligand RCO: RESORCINOL
sequence HL
description RESORCINOL binding site
source pdb_hetatom : RCO_2omi_E_303

67) chain E
residue 6-7
type binding
ligand RCO: RESORCINOL
sequence CC
description RESORCINOL binding site
source pdb_hetatom : RCO_2omi_E_303

68) chain E
residue 9-11
type binding
ligand RCO: RESORCINOL
sequence SIC
description RESORCINOL binding site
source pdb_hetatom : RCO_2omi_E_303

69) chain E
residue 16
type binding
ligand RCO: RESORCINOL
sequence L
description RESORCINOL binding site
source pdb_hetatom : RCO_2omi_E_303

70) chain F
residue 7
type binding
ligand RCO: RESORCINOL
sequence C
description RESORCINOL binding site
source pdb_hetatom : RCO_2omi_E_303

71) chain F
residue 10-11
type binding
ligand RCO: RESORCINOL
sequence HL
description RESORCINOL binding site
source pdb_hetatom : RCO_2omi_E_303

72) chain F
residue 14
type binding
ligand RCO: RESORCINOL
sequence A
description RESORCINOL binding site
source pdb_hetatom : RCO_2omi_E_303

73) chain J
residue 17
type binding
ligand RCO: RESORCINOL
sequence L
description RESORCINOL binding site
source pdb_hetatom : RCO_2omi_E_303

74) chain B
residue 17
type binding
ligand RCO: RESORCINOL
sequence L
description RESORCINOL binding site
source pdb_hetatom : RCO_2omi_G_302

75) chain G
residue 6-7
type binding
ligand RCO: RESORCINOL
sequence CC
description RESORCINOL binding site
source pdb_hetatom : RCO_2omi_G_302

76) chain G
residue 9-11
type binding
ligand RCO: RESORCINOL
sequence SIC
description RESORCINOL binding site
source pdb_hetatom : RCO_2omi_G_302

77) chain G
residue 16
type binding
ligand RCO: RESORCINOL
sequence L
description RESORCINOL binding site
source pdb_hetatom : RCO_2omi_G_302

78) chain H
residue 7
type binding
ligand RCO: RESORCINOL
sequence C
description RESORCINOL binding site
source pdb_hetatom : RCO_2omi_G_302

79) chain H
residue 10-11
type binding
ligand RCO: RESORCINOL
sequence HL
description RESORCINOL binding site
source pdb_hetatom : RCO_2omi_G_302

80) chain H
residue 14
type binding
ligand RCO: RESORCINOL
sequence A
description RESORCINOL binding site
source pdb_hetatom : RCO_2omi_G_302

81) chain J
residue 2
type binding
ligand RCO: RESORCINOL
sequence V
description RESORCINOL binding site
source pdb_hetatom : RCO_2omi_G_302

82) chain J
residue 5-6
type binding
ligand RCO: RESORCINOL
sequence HL
description RESORCINOL binding site
source pdb_hetatom : RCO_2omi_G_302

83) chain C
residue 6-7
type binding
ligand RCO: RESORCINOL
sequence CC
description RESORCINOL binding site
source pdb_hetatom : RCO_2omi_C_306

84) chain C
residue 9-11
type binding
ligand RCO: RESORCINOL
sequence SIC
description RESORCINOL binding site
source pdb_hetatom : RCO_2omi_C_306

85) chain C
residue 13
type binding
ligand RCO: RESORCINOL
sequence L
description RESORCINOL binding site
source pdb_hetatom : RCO_2omi_C_306

86) chain C
residue 16
type binding
ligand RCO: RESORCINOL
sequence L
description RESORCINOL binding site
source pdb_hetatom : RCO_2omi_C_306

87) chain D
residue 7
type binding
ligand RCO: RESORCINOL
sequence C
description RESORCINOL binding site
source pdb_hetatom : RCO_2omi_C_306

88) chain D
residue 10-11
type binding
ligand RCO: RESORCINOL
sequence HL
description RESORCINOL binding site
source pdb_hetatom : RCO_2omi_C_306

89) chain D
residue 14
type binding
ligand RCO: RESORCINOL
sequence A
description RESORCINOL binding site
source pdb_hetatom : RCO_2omi_C_306

90) chain F
residue 2
type binding
ligand RCO: RESORCINOL
sequence V
description RESORCINOL binding site
source pdb_hetatom : RCO_2omi_C_306

91) chain F
residue 5-6
type binding
ligand RCO: RESORCINOL
sequence HL
description RESORCINOL binding site
source pdb_hetatom : RCO_2omi_C_306

92) chain L
residue 17
type binding
ligand RCO: RESORCINOL
sequence L
description RESORCINOL binding site
source pdb_hetatom : RCO_2omi_C_306

93) chain D
residue 17
type binding
ligand RCO: RESORCINOL
sequence L
description RESORCINOL binding site
source pdb_hetatom : RCO_2omi_K_304

94) chain H
residue 2
type binding
ligand RCO: RESORCINOL
sequence V
description RESORCINOL binding site
source pdb_hetatom : RCO_2omi_K_304

95) chain H
residue 5-6
type binding
ligand RCO: RESORCINOL
sequence HL
description RESORCINOL binding site
source pdb_hetatom : RCO_2omi_K_304

96) chain K
residue 6-7
type binding
ligand RCO: RESORCINOL
sequence CC
description RESORCINOL binding site
source pdb_hetatom : RCO_2omi_K_304

97) chain K
residue 9-11
type binding
ligand RCO: RESORCINOL
sequence SIC
description RESORCINOL binding site
source pdb_hetatom : RCO_2omi_K_304

98) chain K
residue 16
type binding
ligand RCO: RESORCINOL
sequence L
description RESORCINOL binding site
source pdb_hetatom : RCO_2omi_K_304

99) chain L
residue 7
type binding
ligand RCO: RESORCINOL
sequence C
description RESORCINOL binding site
source pdb_hetatom : RCO_2omi_K_304

100) chain L
residue 10-11
type binding
ligand RCO: RESORCINOL
sequence HL
description RESORCINOL binding site
source pdb_hetatom : RCO_2omi_K_304

101) chain L
residue 14
type binding
ligand RCO: RESORCINOL
sequence A
description RESORCINOL binding site
source pdb_hetatom : RCO_2omi_K_304

102) chain F
residue 17
type binding
ligand RCO: RESORCINOL
sequence L
description RESORCINOL binding site
source pdb_hetatom : RCO_2omi_I_305

103) chain I
residue 6-7
type binding
ligand RCO: RESORCINOL
sequence CC
description RESORCINOL binding site
source pdb_hetatom : RCO_2omi_I_305

104) chain I
residue 9-11
type binding
ligand RCO: RESORCINOL
sequence SIC
description RESORCINOL binding site
source pdb_hetatom : RCO_2omi_I_305

105) chain I
residue 16
type binding
ligand RCO: RESORCINOL
sequence L
description RESORCINOL binding site
source pdb_hetatom : RCO_2omi_I_305

106) chain J
residue 7
type binding
ligand RCO: RESORCINOL
sequence C
description RESORCINOL binding site
source pdb_hetatom : RCO_2omi_I_305

107) chain J
residue 10-11
type binding
ligand RCO: RESORCINOL
sequence HL
description RESORCINOL binding site
source pdb_hetatom : RCO_2omi_I_305

108) chain J
residue 14
type binding
ligand RCO: RESORCINOL
sequence A
description RESORCINOL binding site
source pdb_hetatom : RCO_2omi_I_305

109) chain L
residue 2
type binding
ligand RCO: RESORCINOL
sequence V
description RESORCINOL binding site
source pdb_hetatom : RCO_2omi_I_305

110) chain L
residue 5-6
type binding
ligand RCO: RESORCINOL
sequence HL
description RESORCINOL binding site
source pdb_hetatom : RCO_2omi_I_305


Display surface

Download
Links