eF-site ID 2okk-A
PDB Code 2okk
Chain A

click to enlarge
Title The X-ray crystal structure of the 65kDa isoform of Glutamic Acid Decarboxylase (GAD65)
Classification LYASE
Compound Glutamate decarboxylase 2
Source Homo sapiens (Human) (DCE2_HUMAN)
Sequence A:  NYAFLHATDLLPACDGERPTLAFLQDVMNILLQYVVKSFD
RSTKVIDFHYPNELLQEYNWELADQPQNLEEILMHCQTTL
KYAIKTGHPRYFNQLSTGLDMVGLAADWLTSTANTNMFTY
EIAPVFVLLEYVTLKKMREIIGWPGGSGDGIFSPGGAISN
MYAMMIARFKMFPEVKEKGMAALPRLIAFTSEHSHFSLKK
GAAALGIGTDSVILIKCDERGKMIPSDLERRILEAKQKGF
VPFLVSATAGTTVYGAFDPLLAVADICKKYKIWMHVDAAW
GGGLLMSRKHKWKLSGVERANSVTWNPHXMMGVPLQCSAL
LVREEGLMQNCNQMHDLSYDTGDKALQCGRHVDVFKLWLM
WRAKGTTGFEAHVDKCLELAEYLYNIIKNREGYEMVFDGK
PQHTNVCFWYIPPSLRTLEERMSRLSKVAPVIKARMMEYG
TTMVSYQPLGDKVNFFRMVISNPAATHQDIDFLIEEIERL
GQD
Description (1)  Glutamate decarboxylase 2 (E.C.4.1.1.15)


Functional site

1) chain A
residue 181
type
ligand
sequence Q
description BINDING SITE FOR RESIDUE ABU A 585
source : AC1

2) chain A
residue 182
type
ligand
sequence L
description BINDING SITE FOR RESIDUE ABU A 585
source : AC1

3) chain A
residue 183
type
ligand
sequence S
description BINDING SITE FOR RESIDUE ABU A 585
source : AC1

4) chain A
residue 205
type
ligand
sequence F
description BINDING SITE FOR RESIDUE ABU A 585
source : AC1

5) chain A
residue 339
type
ligand
sequence T
description BINDING SITE FOR RESIDUE ABU A 585
source : AC1

6) chain A
residue 558
type
ligand
sequence R
description BINDING SITE FOR RESIDUE ABU A 585
source : AC1

7) chain A
residue 181
type
ligand
sequence Q
description BINDING SITE FOR RESIDUE ABU A 586
source : AC2

8) chain A
residue 182
type
ligand
sequence L
description BINDING SITE FOR RESIDUE ABU A 586
source : AC2

9) chain A
residue 183
type
ligand
sequence S
description BINDING SITE FOR RESIDUE ABU A 586
source : AC2

10) chain A
residue 203
type
ligand
sequence N
description BINDING SITE FOR RESIDUE ABU A 586
source : AC2

11) chain A
residue 282
type
ligand
sequence H
description BINDING SITE FOR RESIDUE ABU A 586
source : AC2

12) chain A
residue 396
type
ligand
sequence X
description BINDING SITE FOR RESIDUE ABU A 586
source : AC2

13) chain A
residue 446
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ABU A 586
source : AC2

14) chain A
residue 279
type
ligand
sequence E
description BINDING SITE FOR RESIDUE GOL A 587
source : AC3

15) chain A
residue 281
type
ligand
sequence S
description BINDING SITE FOR RESIDUE GOL A 587
source : AC3

16) chain A
residue 282
type
ligand
sequence H
description BINDING SITE FOR RESIDUE GOL A 587
source : AC3

17) chain A
residue 283
type
ligand
sequence F
description BINDING SITE FOR RESIDUE GOL A 587
source : AC3

18) chain A
residue 286
type
ligand
sequence K
description BINDING SITE FOR RESIDUE GOL A 587
source : AC3

19) chain A
residue 471
type BINDING
ligand
sequence V
description Substrate.
source Swiss-Prot : SWS_FT_FI1

20) chain A
residue 389-410
type prosite
ligand
sequence SVTWNPHXMMGVPLQCSALLVR
description DDC / GAD / HDC / TyrDC pyridoxal-phosphate attachment site. S-[LIVMFYW]-x-{KG}-x(3)-K-[LIVMFYWGH]-[LIVMFYWG]-x-{R}-x-[LIVMFYW]-{V}
source prosite : PS00392

21) chain A
residue 180-183
type binding
ligand ABU: GAMMA-AMINO-BUTANOIC ACID
sequence NQLS
description GAMMA-AMINO-BUTANOIC ACID binding site
source pdb_hetatom : ABU_2okk_A_585

22) chain A
residue 339
type binding
ligand ABU: GAMMA-AMINO-BUTANOIC ACID
sequence T
description GAMMA-AMINO-BUTANOIC ACID binding site
source pdb_hetatom : ABU_2okk_A_585

23) chain A
residue 396
type binding
ligand ABU: GAMMA-AMINO-BUTANOIC ACID
sequence X
description GAMMA-AMINO-BUTANOIC ACID binding site
source pdb_hetatom : ABU_2okk_A_585

24) chain A
residue 546
type binding
ligand ABU: GAMMA-AMINO-BUTANOIC ACID
sequence S
description GAMMA-AMINO-BUTANOIC ACID binding site
source pdb_hetatom : ABU_2okk_A_585

25) chain A
residue 558
type binding
ligand ABU: GAMMA-AMINO-BUTANOIC ACID
sequence R
description GAMMA-AMINO-BUTANOIC ACID binding site
source pdb_hetatom : ABU_2okk_A_585

26) chain A
residue 181-183
type binding
ligand ABU: GAMMA-AMINO-BUTANOIC ACID
sequence QLS
description GAMMA-AMINO-BUTANOIC ACID binding site
source pdb_hetatom : ABU_2okk_A_586

27) chain A
residue 282-283
type binding
ligand ABU: GAMMA-AMINO-BUTANOIC ACID
sequence HF
description GAMMA-AMINO-BUTANOIC ACID binding site
source pdb_hetatom : ABU_2okk_A_586

28) chain A
residue 339
type binding
ligand ABU: GAMMA-AMINO-BUTANOIC ACID
sequence T
description GAMMA-AMINO-BUTANOIC ACID binding site
source pdb_hetatom : ABU_2okk_A_586

29) chain A
residue 395-396
type binding
ligand ABU: GAMMA-AMINO-BUTANOIC ACID
sequence HX
description GAMMA-AMINO-BUTANOIC ACID binding site
source pdb_hetatom : ABU_2okk_A_586

30) chain A
residue 277-283
type binding
ligand GOL: GLYCEROL
sequence TSEHSHF
description GLYCEROL binding site
source pdb_hetatom : GOL_2okk_A_587

31) chain A
residue 285-286
type binding
ligand GOL: GLYCEROL
sequence LK
description GLYCEROL binding site
source pdb_hetatom : GOL_2okk_A_587

32) chain A
residue 301
type binding
ligand GOL: GLYCEROL
sequence L
description GLYCEROL binding site
source pdb_hetatom : GOL_2okk_A_587

33) chain A
residue 364
type catalytic
ligand
sequence D
description Annotated By Reference To The Literature 1ecx
source CSA : CSA1

34) chain A
residue 282
type catalytic
ligand
sequence H
description Annotated By Reference To The Literature 1ecx
source CSA : CSA1

35) chain A
residue 280
type catalytic
ligand
sequence H
description Annotated By Reference To The Literature 1ecx
source CSA : CSA2

36) chain A
residue 364
type catalytic
ligand
sequence D
description Annotated By Reference To The Literature 1ecx
source CSA : CSA2

37) chain A
residue 364
type catalytic
ligand
sequence D
description Annotated By Reference To The Literature 1ecx
source CSA : CSA3

38) chain A
residue 283
type catalytic
ligand
sequence F
description Annotated By Reference To The Literature 1ecx
source CSA : CSA3


Display surface

Download
Links