eF-site ID 2odb-AB PDB Code 2odb Chain A, B click to enlarge Title The crystal structure of human cdc42 in complex with the CRIB domain of human p21-activated kinase 6 (PAK6) Classification PROTEIN BINDING Compound Human Cell Division Cycle 42 (CDC42) Source null (CDC42_HUMAN) Sequence A:  QTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYA VTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVC FSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRD DPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALT QKGLKNVFDEAILAALE B:  EISAPQNFQHRVHTSFDPKEGKFVGLPPQWQNILD Description Functional site 1) chain A residue 2 type sequence Q description BINDING SITE FOR RESIDUE CL A 204 source : AC1 2) chain A residue 17 type sequence T description BINDING SITE FOR RESIDUE MG A 205 source : AC2 3) chain A residue 35 type sequence T description BINDING SITE FOR RESIDUE MG A 205 source : AC2 4) chain B residue 14 type sequence A description BINDING SITE FOR RESIDUE SO4 B 201 source : AC3 5) chain B residue 14 type sequence A description BINDING SITE FOR RESIDUE SO4 B 201 source : AC3 6) chain A residue 47 type sequence G description BINDING SITE FOR RESIDUE SO4 A 202 source : AC4 7) chain B residue 11 type sequence E description BINDING SITE FOR RESIDUE SO4 A 202 source : AC4 8) chain B residue 16 type sequence Q description BINDING SITE FOR RESIDUE SO4 A 202 source : AC4 9) chain B residue 17 type sequence N description BINDING SITE FOR RESIDUE SO4 A 202 source : AC4 10) chain A residue 5 type sequence K description BINDING SITE FOR RESIDUE SO4 A 203 source : AC5 11) chain A residue 56 type sequence F description BINDING SITE FOR RESIDUE SO4 A 203 source : AC5 12) chain A residue 73 type sequence P description BINDING SITE FOR RESIDUE SO4 A 203 source : AC5 13) chain A residue 74 type sequence Q description BINDING SITE FOR RESIDUE SO4 A 203 source : AC5 14) chain B residue 39 type sequence Q description BINDING SITE FOR RESIDUE SO4 A 203 source : AC5 15) chain A residue 12 type sequence G description BINDING SITE FOR RESIDUE GCP A 200 source : AC6 16) chain A residue 13 type sequence A description BINDING SITE FOR RESIDUE GCP A 200 source : AC6 17) chain A residue 14 type sequence V description BINDING SITE FOR RESIDUE GCP A 200 source : AC6 18) chain A residue 15 type sequence G description BINDING SITE FOR RESIDUE GCP A 200 source : AC6 19) chain A residue 16 type sequence K description BINDING SITE FOR RESIDUE GCP A 200 source : AC6 20) chain A residue 17 type sequence T description BINDING SITE FOR RESIDUE GCP A 200 source : AC6 21) chain A residue 18 type sequence C description BINDING SITE FOR RESIDUE GCP A 200 source : AC6 22) chain A residue 28 type sequence F description BINDING SITE FOR RESIDUE GCP A 200 source : AC6 23) chain A residue 32 type sequence Y description BINDING SITE FOR RESIDUE GCP A 200 source : AC6 24) chain A residue 34 type sequence P description BINDING SITE FOR RESIDUE GCP A 200 source : AC6 25) chain A residue 35 type sequence T description BINDING SITE FOR RESIDUE GCP A 200 source : AC6 26) chain A residue 60 type sequence G description BINDING SITE FOR RESIDUE GCP A 200 source : AC6 27) chain A residue 116 type sequence Q description BINDING SITE FOR RESIDUE GCP A 200 source : AC6 28) chain A residue 118 type sequence D description BINDING SITE FOR RESIDUE GCP A 200 source : AC6 29) chain A residue 119 type sequence L description BINDING SITE FOR RESIDUE GCP A 200 source : AC6 30) chain A residue 158 type sequence S description BINDING SITE FOR RESIDUE GCP A 200 source : AC6 31) chain A residue 159 type sequence A description BINDING SITE FOR RESIDUE GCP A 200 source : AC6 32) chain A residue 160 type sequence L description BINDING SITE FOR RESIDUE GCP A 200 source : AC6 33) chain A residue 35 type CARBOHYD sequence T description (Microbial infection) O-linked (Glc) threonine; by C.difficile toxins TcdA and TcdB; alternate => ECO:0000269|PubMed:24905543, ECO:0000269|PubMed:7775453, ECO:0000269|PubMed:7777059 source Swiss-Prot : SWS_FT_FI9 34) chain A residue 32 type MOD_RES sequence Y description (Microbial infection) O-AMP-tyrosine; by Haemophilus IbpA; alternate => ECO:0000269|PubMed:19362538, ECO:0000269|PubMed:20622875 source Swiss-Prot : SWS_FT_FI3 35) chain A residue 35 type MOD_RES sequence T description (Microbial infection) O-AMP-threonine; by Vibrio VopS => ECO:0000269|PubMed:19039103 source Swiss-Prot : SWS_FT_FI4 36) chain A residue 64 type MOD_RES sequence Y description Phosphotyrosine; by SRC => ECO:0000269|PubMed:14506284 source Swiss-Prot : SWS_FT_FI5 37) chain A residue 32 type CARBOHYD sequence Y description (Microbial infection) O-linked (GlcNAc) tyrosine; by Photorhabdus PAU_02230; alternate => ECO:0000269|PubMed:24141704 source Swiss-Prot : SWS_FT_FI8 38) chain A residue 10 type BINDING sequence G description source Swiss-Prot : SWS_FT_FI1 39) chain A residue 115 type BINDING sequence T description source Swiss-Prot : SWS_FT_FI1 40) chain A residue 57 type BINDING sequence D description BINDING => ECO:0000250 source Swiss-Prot : SWS_FT_FI2

Display surface Download Links