eF-site ID 2ocz-A PDB Code 2ocz Chain A click to enlarge Title The Structure of a Putative 3-Dehydroquinate Dehydratase from Streptococcus pyogenes. Classification LYASE Compound 3-dehydroquinate dehydratase Source null (AROD_STRP1) Sequence A:  AXRIVAPVXPRHFDEAQAIDISKYEDVNLIEWRADFLPKD EIVAVAPAIFEKFAGKEIIFTLRTVQEGGNITLSSQEYVD IIKEINAIYNPDYIDFEYFTHKSVFQEXLDFPNLILSYHN FEETPENLXEAFSEXTKLAPRVVKIAVXPQSEQDVLDLXN YTRGFKTLNPEQEFATISXGKLGRLSRFAGDVIGSSWTYV SLGQVTLNDXKRIIEVLE Description Functional site 1) chain A residue 89 type sequence N description BINDING SITE FOR RESIDUE MG A 401 source : AC1 2) chain A residue 105 type sequence Q description BINDING SITE FOR RESIDUE EDO A 501 source : AC2 3) chain A residue 108 type sequence L description BINDING SITE FOR RESIDUE EDO A 501 source : AC2 4) chain A residue 137 type sequence L description BINDING SITE FOR RESIDUE EDO A 501 source : AC2 5) chain A residue 108 type sequence L description BINDING SITE FOR RESIDUE EDO A 502 source : AC3 6) chain A residue 110 type sequence F description BINDING SITE FOR RESIDUE EDO A 502 source : AC3 7) chain A residue 179 type sequence G description BINDING SITE FOR RESIDUE EDO A 503 source : AC4 8) chain A residue 186 type sequence R description BINDING SITE FOR RESIDUE EDO A 503 source : AC4 9) chain A residue 208 type sequence G description BINDING SITE FOR RESIDUE EDO A 503 source : AC4 10) chain A residue 209 type sequence Q description BINDING SITE FOR RESIDUE EDO A 503 source : AC4 11) chain A residue 117 type sequence Y description BINDING SITE FOR RESIDUE EDO A 504 source : AC5 12) chain A residue 124 type sequence P description BINDING SITE FOR RESIDUE EDO A 504 source : AC5 13) chain A residue 126 type sequence N description BINDING SITE FOR RESIDUE EDO A 504 source : AC5 14) chain A residue 118 type ACT_SITE sequence H description Proton donor/acceptor => ECO:0000255|HAMAP-Rule:MF_00214 source Swiss-Prot : SWS_FT_FI1 15) chain A residue 143 type ACT_SITE sequence K description Schiff-base intermediate with substrate => ECO:0000255|HAMAP-Rule:MF_00214 source Swiss-Prot : SWS_FT_FI2 16) chain A residue 30 type BINDING sequence E description BINDING => ECO:0000255|HAMAP-Rule:MF_00214 source Swiss-Prot : SWS_FT_FI3 17) chain A residue 62 type BINDING sequence R description BINDING => ECO:0000255|HAMAP-Rule:MF_00214 source Swiss-Prot : SWS_FT_FI3 18) chain A residue 186 type BINDING sequence R description BINDING => ECO:0000255|HAMAP-Rule:MF_00214 source Swiss-Prot : SWS_FT_FI3 19) chain A residue 209 type BINDING sequence Q description BINDING => ECO:0000255|HAMAP-Rule:MF_00214 source Swiss-Prot : SWS_FT_FI3

Display surface Download Links