eF-site ID 2o9l_3-A
PDB Code 2o9l
Model 3
Chain A

click to enlarge
Title AMBER refined NMR Structure of the Sigma-54 RpoN Domain Bound to the-24 Promoter Element
Classification RNA POLYMERASE SIGMA FACTOR RPON/DNA
Compound 5'-D(*TP*TP*TP*TP*GP*GP*CP*AP*CP*GP*TP*TP*TP*C)-3'
Source Aquifex aeolicus (2O9L)
Sequence A:  HMLTQGELMKLIKEIVENEDKRKPYSDQEIANILKEKGFK
VARRTVAKYREMLGIPSSRERRI
Description (1)  RNA POLYMERASE SIGMA FACTOR RPON/DNA


Functional site

1) chain A
residue 43-50
type prosite
ligand
sequence RRTVAKYR
description Sigma-54 factors family signature 2. R-R-T-[IV]-[ATN]-K-Y-R
source prosite : PS00718


Display surface

Download
Links