eF-site ID 2o3k-A PDB Code 2o3k Chain A click to enlarge Title Yeast Cytosine Deaminase D92E Triple Mutant bound to transition state analogue HPY Classification HYDROLASE Compound Cytosine deaminase Source Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (FCY1_YEAST) Sequence A:  GMASKWDQKGMDIAYEEALLGYKEGGVPIGGCLINNKDGS VLGRGHNMRFQKGSATLHGEISTLENCGRLEGKVYKDTTL YTTLSPCEMCTGAIIMYGIPRCVIGENVNFKSKGEKYLQT RGHEVVVVDDERCKKLMKQFIDERPQDWFEDIGE Description Functional site 1) chain A residue 62 type sequence H description BINDING SITE FOR RESIDUE ZN A 401 source : AC2 2) chain A residue 91 type sequence C description BINDING SITE FOR RESIDUE ZN A 401 source : AC2 3) chain A residue 94 type sequence C description BINDING SITE FOR RESIDUE ZN A 401 source : AC2 4) chain A residue 128 type sequence E description BINDING SITE FOR RESIDUE CA B 403 source : AC3 5) chain A residue 150 type sequence Q description BINDING SITE FOR RESIDUE CA B 403 source : AC3 6) chain A residue 33 type sequence I description BINDING SITE FOR RESIDUE HPY A 411 source : AC5 7) chain A residue 51 type sequence N description BINDING SITE FOR RESIDUE HPY A 411 source : AC5 8) chain A residue 62 type sequence H description BINDING SITE FOR RESIDUE HPY A 411 source : AC5 9) chain A residue 63 type sequence G description BINDING SITE FOR RESIDUE HPY A 411 source : AC5 10) chain A residue 64 type sequence E description BINDING SITE FOR RESIDUE HPY A 411 source : AC5 11) chain A residue 90 type sequence P description BINDING SITE FOR RESIDUE HPY A 411 source : AC5 12) chain A residue 91 type sequence C description BINDING SITE FOR RESIDUE HPY A 411 source : AC5 13) chain A residue 94 type sequence C description BINDING SITE FOR RESIDUE HPY A 411 source : AC5 14) chain A residue 155 type sequence D description BINDING SITE FOR RESIDUE HPY A 411 source : AC5 15) chain A residue 62 type catalytic sequence H description 636 source MCSA : MCSA1 16) chain A residue 64 type catalytic sequence E description 636 source MCSA : MCSA1 17) chain A residue 89 type catalytic sequence S description 636 source MCSA : MCSA1 18) chain A residue 91 type catalytic sequence C description 636 source MCSA : MCSA1 19) chain A residue 94 type catalytic sequence C description 636 source MCSA : MCSA1 20) chain A residue 64 type ACT_SITE sequence E description Proton donor => ECO:0000269|PubMed:12637534, ECO:0007744|PDB:1UAQ source Swiss-Prot : SWS_FT_FI1 21) chain A residue 51 type BINDING sequence N description BINDING => ECO:0000269|PubMed:12637534, ECO:0000269|PubMed:12906827, ECO:0007744|PDB:1P6O, ECO:0007744|PDB:1UAQ source Swiss-Prot : SWS_FT_FI2 22) chain A residue 155 type BINDING sequence D description BINDING => ECO:0000269|PubMed:12637534, ECO:0000269|PubMed:12906827, ECO:0007744|PDB:1P6O, ECO:0007744|PDB:1UAQ source Swiss-Prot : SWS_FT_FI2 23) chain A residue 62 type BINDING sequence H description BINDING => ECO:0000269|PubMed:12637534, ECO:0000269|PubMed:12906827, ECO:0000269|PubMed:15879217, ECO:0007744|PDB:1OX7, ECO:0007744|PDB:1P6O, ECO:0007744|PDB:1RB7, ECO:0007744|PDB:1UAQ, ECO:0007744|PDB:1YSB, ECO:0007744|PDB:1YSD source Swiss-Prot : SWS_FT_FI3 24) chain A residue 91 type BINDING sequence C description BINDING => ECO:0000269|PubMed:12637534, ECO:0000269|PubMed:12906827, ECO:0000269|PubMed:15879217, ECO:0007744|PDB:1OX7, ECO:0007744|PDB:1P6O, ECO:0007744|PDB:1RB7, ECO:0007744|PDB:1UAQ, ECO:0007744|PDB:1YSB, ECO:0007744|PDB:1YSD source Swiss-Prot : SWS_FT_FI3 25) chain A residue 94 type BINDING sequence C description BINDING => ECO:0000269|PubMed:12637534, ECO:0000269|PubMed:12906827, ECO:0000269|PubMed:15879217, ECO:0007744|PDB:1OX7, ECO:0007744|PDB:1P6O, ECO:0007744|PDB:1RB7, ECO:0007744|PDB:1UAQ, ECO:0007744|PDB:1YSB, ECO:0007744|PDB:1YSD source Swiss-Prot : SWS_FT_FI3 26) chain A residue 62-98 type prosite sequence HGEISTLENCGRLEGKVYKDTTLYTTLSPCEMCTGAI description CYT_DCMP_DEAMINASES_1 Cytidine and deoxycytidylate deaminases zinc-binding region signature. HGEisTLencgrlegkvykdttlyttls............PCem......CtgaI source prosite : PS00903

Display surface Download Links