eF-site ID 2o2m-A PDB Code 2o2m Chain A click to enlarge Title Solution structure of the anti-apoptotic protein Bcl-xL in complex with an acyl-sulfonamide-based ligand Classification APOPTOSIS Compound Apoptosis regulator Bcl-X Source null (BCLX_HUMAN) Sequence A:  SQSNRELVVDFLSYKLSQKGYSAGGGGGGGGMAAVKQALR EAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELF RDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMA TYLNDHLEPWIQENGGWDTFVELYG Description Functional site 1) chain A residue 101 type sequence F description BINDING SITE FOR RESIDUE LI0 A 1000 source : AC1 2) chain A residue 105 type sequence Y description BINDING SITE FOR RESIDUE LI0 A 1000 source : AC1 3) chain A residue 112 type sequence L description BINDING SITE FOR RESIDUE LI0 A 1000 source : AC1 4) chain A residue 133 type sequence E description BINDING SITE FOR RESIDUE LI0 A 1000 source : AC1 5) chain A residue 134 type sequence L description BINDING SITE FOR RESIDUE LI0 A 1000 source : AC1 6) chain A residue 140 type sequence N description BINDING SITE FOR RESIDUE LI0 A 1000 source : AC1 7) chain A residue 141 type sequence W description BINDING SITE FOR RESIDUE LI0 A 1000 source : AC1 8) chain A residue 142 type sequence G description BINDING SITE FOR RESIDUE LI0 A 1000 source : AC1 9) chain A residue 143 type sequence R description BINDING SITE FOR RESIDUE LI0 A 1000 source : AC1 10) chain A residue 145 type sequence V description BINDING SITE FOR RESIDUE LI0 A 1000 source : AC1 11) chain A residue 195 type sequence F description BINDING SITE FOR RESIDUE LI0 A 1000 source : AC1 12) chain A residue 199 type sequence Y description BINDING SITE FOR RESIDUE LI0 A 1000 source : AC1 13) chain A residue 93 type SITE sequence A description Cleavage; by caspase-1 source Swiss-Prot : SWS_FT_FI1 14) chain A residue 94 type MOD_RES sequence L description Phosphoserine; by CDK1 => ECO:0000269|PubMed:19917720 source Swiss-Prot : SWS_FT_FI2 15) chain A residue 134-152 type prosite sequence LFRDGVNWGRIVAFFSFGG description BH1 Apoptosis regulator, Bcl-2 family BH1 motif signature. LFrDGv.NWGRIVAFFsFGG source prosite : PS01080 16) chain A residue 185-196 type prosite sequence WIQENGGWDTFV description BH2 Apoptosis regulator, Bcl-2 family BH2 motif signature. WIqenGGWDtFV source prosite : PS01258 17) chain A residue 90-104 type prosite sequence VKQALREAGDEFELR description BH3 Apoptosis regulator, Bcl-2 family BH3 motif signature. VkqaLReAGDEFELR source prosite : PS01259

Display surface Download Links