eF-site ID 2o2f-A PDB Code 2o2f Chain A click to enlarge Title Solution structure of the anti-apoptotic protein Bcl-2 in complex with an acyl-sulfonamide-based ligand Classification APOPTOSIS Compound Apoptosis regulator Bcl-2 Source Homo sapiens (Human) (BCL2_HUMAN) Sequence A:  GYDNREIVMKYIHYKLSQRGYEWDEVVHLTLRQAGDDFSR RYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGR IVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLH TWIQDNGGWDAFVELYGP Description Functional site 1) chain A residue 97 type sequence A description BINDING SITE FOR RESIDUE LI0 A 1000 source : AC1 2) chain A residue 100 type sequence D description BINDING SITE FOR RESIDUE LI0 A 1000 source : AC1 3) chain A residue 105 type sequence Y description BINDING SITE FOR RESIDUE LI0 A 1000 source : AC1 4) chain A residue 108 type sequence D description BINDING SITE FOR RESIDUE LI0 A 1000 source : AC1 5) chain A residue 112 type sequence M description BINDING SITE FOR RESIDUE LI0 A 1000 source : AC1 6) chain A residue 130 type sequence V description BINDING SITE FOR RESIDUE LI0 A 1000 source : AC1 7) chain A residue 134 type sequence L description BINDING SITE FOR RESIDUE LI0 A 1000 source : AC1 8) chain A residue 141 type sequence W description BINDING SITE FOR RESIDUE LI0 A 1000 source : AC1 9) chain A residue 142 type sequence G description BINDING SITE FOR RESIDUE LI0 A 1000 source : AC1 10) chain A residue 145 type sequence V description BINDING SITE FOR RESIDUE LI0 A 1000 source : AC1 11) chain A residue 146 type sequence A description BINDING SITE FOR RESIDUE LI0 A 1000 source : AC1 12) chain A residue 199 type sequence Y description BINDING SITE FOR RESIDUE LI0 A 1000 source : AC1 13) chain A residue 134-152 type prosite sequence LFRDGVNWGRIVAFFEFGG description BH1 Apoptosis regulator, Bcl-2 family BH1 motif signature. LFrDGv.NWGRIVAFFeFGG source prosite : PS01080 14) chain A residue 185-196 type prosite sequence WIQDNGGWDAFV description BH2 Apoptosis regulator, Bcl-2 family BH2 motif signature. WIqdnGGWDaFV source prosite : PS01258 15) chain A residue 90-104 type prosite sequence VHLTLRQAGDDFSRR description BH3 Apoptosis regulator, Bcl-2 family BH3 motif signature. VhltLRqAGDDFSRR source prosite : PS01259 16) chain A residue 8-28 type prosite sequence DNREIVMKYIHYKLSQRGYEW description BH4_1 Apoptosis regulator, Bcl-2 family BH4 motif signature. DNREIVmKYIHYKLSQRGYeW source prosite : PS01260 17) chain A residue 90 type SITE sequence V description Cleavage; by caspase-3 source Swiss-Prot : SWS_FT_FI1 18) chain A residue 125 type MOD_RES sequence G description Phosphothreonine; by MAPK8 => ECO:0000269|PubMed:18570871 source Swiss-Prot : SWS_FT_FI2 19) chain A residue 126 type MOD_RES sequence R description Phosphoserine; by MAPK8 and PKC => ECO:0000269|PubMed:18570871 source Swiss-Prot : SWS_FT_FI3 20) chain A residue 143 type MOD_RES sequence R description Phosphoserine; by MAPK8 => ECO:0000269|PubMed:18570871 source Swiss-Prot : SWS_FT_FI4

Display surface Download Links