eF-site ID 2o24-A
PDB Code 2o24
Chain A

click to enlarge
Title Spectroscopic and Structural Study of the Heterotropic Linkage between Halide and Proton Ion Binding to Gfp Proteins: E2(GFP)-Cl Complex
Classification LUMINESCENT PROTEIN
Compound Green fluorescent protein
Source Aequorea victoria (Jellyfish) (GFP_AEQVI)
Sequence A:  GIDPFTVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGE
GDATYGKLTLKFICTTGKLPVPWPTLVTTLXVQCFSRYPD
HMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEG
DTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADK
QKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLP
DNHYLSYQSALSKDPNEKRDHMVLLEFVTAAGITELY
Description (1)  Green fluorescent protein


Functional site

1) chain A
residue 1066
type
ligand
sequence X
description BINDING SITE FOR RESIDUE CL A 1240
source : AC1

2) chain A
residue 1068
type
ligand
sequence V
description BINDING SITE FOR RESIDUE CL A 1240
source : AC1

3) chain A
residue 1069
type
ligand
sequence Q
description BINDING SITE FOR RESIDUE CL A 1240
source : AC1

4) chain A
residue 1203
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE CL A 1240
source : AC1

5) chain A
residue 1144
type
ligand
sequence N
description BINDING SITE FOR RESIDUE CL A 1241
source : AC2

6) chain A
residue 1145
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE CL A 1241
source : AC2

7) chain A
residue 1207
type
ligand
sequence L
description BINDING SITE FOR RESIDUE CL A 1241
source : AC2

8) chain A
residue 1057
type
ligand
sequence W
description BINDING SITE FOR RESIDUE CL A 1242
source : AC3


Display surface

Download
Links