eF-site ID 2o01-A PDB Code 2o01 Chain A click to enlarge Title The Structure of a plant photosystem I supercomplex at 3.4 Angstrom resolution Classification PHOTOSYNTHESIS Compound Photosystem I P700 chlorophyll a apoprotein A1 Source ORGANISM_COMMON: pea; ORGANISM_SCIENTIFIC: Pisum sativum; Sequence A:  FEQWAKPGHFSRTIAKGPDTTTWIWNLHADAHDFDSHTSD LEEISRKVFSAHFGQLSIIFLWLSGMYFHGARFSNYEAWL NDPTHIGPSAQVVWPIVGQEILNGDVGGGFRGIQITSGFF QIWRASGITSELQLYCTAIGALVFAGLMLFAGWFHYHKAA PKLAWFQDVESMLNHHLAGLLGLGSLSWAGHQVHVSLPIN QFLNAGVDPKEIPLPHEFILNRDLLAQLYPSFAEGATPFF TLNWSKYADFLTFRGGLDPLTGGLWLTDIAHHHLAIAILF LIAGHMYRTNWGIGHGIKDILEAHKGPFTGQGHKGLYEIL TTSWHAQLSINLAMLGSLTIVVAQHMYSMPPYPYLATDYA TQLSLFTHHMWIGGFLIVGAAAHAAIFMVRDYDPTTRYND LLDRVLRHRDAIISHLNWVCIFLGFHSFGLYIHNDTMSAL GRPQDMFSDTAIQLQPVFAQWIQNTHALAPGTTAPGATAS TSLTWGGGDLVAVGNKVALLPIPLGTADFLVHHIHAFTIH VTVLILLKGVLFARSSRLIPDKANLGFRFPCDGPGRGGTC QVSAWDHVFLGLFWMYNSISVVIFHFSWKMQSDVWGTIND QGVVTHITAGNFAQSSITINGWLRDFLWAQASQVIQSYGS SLSAYGLFFLGAHFVWAFSLMFLFSGRGYWQELIESIVWA HNKLKVAPATQPRALSIVQGRAVGVTHYLLGGIATTWAFF LARIIAVG Description Functional site 1) chain A residue 54 type sequence I description BINDING SITE FOR RESIDUE CLA A 1101 source : AC1 2) chain A residue 58 type sequence H description BINDING SITE FOR RESIDUE CLA A 1101 source : AC1 3) chain A residue 62 type sequence H description BINDING SITE FOR RESIDUE CLA A 1102 source : AC2 4) chain A residue 62 type sequence H description BINDING SITE FOR RESIDUE CLA A 1103 source : AC3 5) chain A residue 64 type sequence F description BINDING SITE FOR RESIDUE CLA A 1103 source : AC3 6) chain A residue 78 type sequence V description BINDING SITE FOR RESIDUE CLA A 1103 source : AC3 7) chain A residue 81 type sequence A description BINDING SITE FOR RESIDUE CLA A 1103 source : AC3 8) chain A residue 82 type sequence H description BINDING SITE FOR RESIDUE CLA A 1103 source : AC3 9) chain A residue 85 type sequence Q description BINDING SITE FOR RESIDUE CLA A 1103 source : AC3 10) chain A residue 86 type sequence L description BINDING SITE FOR RESIDUE CLA A 1103 source : AC3 11) chain A residue 354 type sequence W description BINDING SITE FOR RESIDUE CLA A 1103 source : AC3 12) chain A residue 355 type sequence H description BINDING SITE FOR RESIDUE CLA A 1103 source : AC3 13) chain A residue 358 type sequence L description BINDING SITE FOR RESIDUE CLA A 1103 source : AC3 14) chain A residue 361 type sequence N description BINDING SITE FOR RESIDUE CLA A 1103 source : AC3 15) chain A residue 362 type sequence L description BINDING SITE FOR RESIDUE CLA A 1103 source : AC3 16) chain A residue 365 type sequence L description BINDING SITE FOR RESIDUE CLA A 1103 source : AC3 17) chain A residue 85 type sequence Q description BINDING SITE FOR RESIDUE CLA A 1104 source : AC4 18) chain A residue 89 type sequence I description BINDING SITE FOR RESIDUE CLA A 1104 source : AC4 19) chain A residue 94 type sequence S description BINDING SITE FOR RESIDUE CLA A 1105 source : AC5 20) chain A residue 98 type sequence F description BINDING SITE FOR RESIDUE CLA A 1105 source : AC5 21) chain A residue 99 type sequence H description BINDING SITE FOR RESIDUE CLA A 1105 source : AC5 22) chain A residue 120 type sequence A description BINDING SITE FOR RESIDUE CLA A 1106 source : AC6 23) chain A residue 145 type sequence I description BINDING SITE FOR RESIDUE CLA A 1106 source : AC6 24) chain A residue 146 type sequence T description BINDING SITE FOR RESIDUE CLA A 1106 source : AC6 25) chain A residue 675 type sequence Y description BINDING SITE FOR RESIDUE CLA A 1106 source : AC6 26) chain A residue 121 type sequence Q description BINDING SITE FOR RESIDUE CLA A 1107 source : AC7 27) chain A residue 124 type sequence W description BINDING SITE FOR RESIDUE CLA A 1107 source : AC7 28) chain A residue 129 type sequence Q description BINDING SITE FOR RESIDUE CLA A 1107 source : AC7 29) chain A residue 132 type sequence L description BINDING SITE FOR RESIDUE CLA A 1107 source : AC7 30) chain A residue 204 type sequence N description BINDING SITE FOR RESIDUE CLA A 1108 source : AC8 31) chain A residue 205 type sequence H description BINDING SITE FOR RESIDUE CLA A 1108 source : AC8 32) chain A residue 311 type sequence L description BINDING SITE FOR RESIDUE CLA A 1108 source : AC8 33) chain A residue 312 type sequence I description BINDING SITE FOR RESIDUE CLA A 1108 source : AC8 34) chain A residue 314 type sequence G description BINDING SITE FOR RESIDUE CLA A 1108 source : AC8 35) chain A residue 315 type sequence H description BINDING SITE FOR RESIDUE CLA A 1108 source : AC8 36) chain A residue 317 type sequence Y description BINDING SITE FOR RESIDUE CLA A 1108 source : AC8 37) chain A residue 319 type sequence T description BINDING SITE FOR RESIDUE CLA A 1108 source : AC8 38) chain A residue 323 type sequence I description BINDING SITE FOR RESIDUE CLA A 1108 source : AC8 39) chain A residue 33 type sequence Q description BINDING SITE FOR RESIDUE CLA A 1109 source : AC9 40) chain A residue 77 type sequence K description BINDING SITE FOR RESIDUE CLA A 1109 source : AC9 41) chain A residue 80 type sequence S description BINDING SITE FOR RESIDUE CLA A 1109 source : AC9 42) chain A residue 81 type sequence A description BINDING SITE FOR RESIDUE CLA A 1109 source : AC9 43) chain A residue 186 type sequence Y description BINDING SITE FOR RESIDUE CLA A 1109 source : AC9 44) chain A residue 187 type sequence H description BINDING SITE FOR RESIDUE CLA A 1109 source : AC9 45) chain A residue 202 type sequence M description BINDING SITE FOR RESIDUE CLA A 1111 source : BC2 46) chain A residue 210 type sequence L description BINDING SITE FOR RESIDUE CLA A 1111 source : BC2 47) chain A residue 216 type sequence L description BINDING SITE FOR RESIDUE CLA A 1113 source : BC3 48) chain A residue 219 type sequence A description BINDING SITE FOR RESIDUE CLA A 1113 source : BC3 49) chain A residue 220 type sequence G description BINDING SITE FOR RESIDUE CLA A 1113 source : BC3 50) chain A residue 224 type sequence H description BINDING SITE FOR RESIDUE CLA A 1113 source : BC3 51) chain A residue 249 type sequence I description BINDING SITE FOR RESIDUE CLA A 1113 source : BC3 52) chain A residue 250 type sequence L description BINDING SITE FOR RESIDUE CLA A 1113 source : BC3 53) chain A residue 252 type sequence R description BINDING SITE FOR RESIDUE CLA A 1113 source : BC3 54) chain A residue 263 type sequence A description BINDING SITE FOR RESIDUE CLA A 1113 source : BC3 55) chain A residue 277 type sequence Y description BINDING SITE FOR RESIDUE CLA A 1113 source : BC3 56) chain A residue 274 type sequence W description BINDING SITE FOR RESIDUE CLA A 1115 source : BC4 57) chain A residue 278 type sequence A description BINDING SITE FOR RESIDUE CLA A 1115 source : BC4 58) chain A residue 281 type sequence L description BINDING SITE FOR RESIDUE CLA A 1115 source : BC4 59) chain A residue 305 type sequence A description BINDING SITE FOR RESIDUE CLA A 1115 source : BC4 60) chain A residue 283 type sequence F description BINDING SITE FOR RESIDUE CLA A 1116 source : BC5 61) chain A residue 298 type sequence D description BINDING SITE FOR RESIDUE CLA A 1116 source : BC5 62) chain A residue 302 type sequence H description BINDING SITE FOR RESIDUE CLA A 1116 source : BC5 63) chain A residue 375 type sequence H description BINDING SITE FOR RESIDUE CLA A 1116 source : BC5 64) chain A residue 302 type sequence H description BINDING SITE FOR RESIDUE CLA A 1117 source : BC6 65) chain A residue 195 type sequence W description BINDING SITE FOR RESIDUE CLA A 1118 source : BC7 66) chain A residue 203 type sequence L description BINDING SITE FOR RESIDUE CLA A 1119 source : BC8 67) chain A residue 316 type sequence M description BINDING SITE FOR RESIDUE CLA A 1119 source : BC8 68) chain A residue 317 type sequence Y description BINDING SITE FOR RESIDUE CLA A 1119 source : BC8 69) chain A residue 325 type sequence H description BINDING SITE FOR RESIDUE CLA A 1120 source : BC9 70) chain A residue 331 type sequence L description BINDING SITE FOR RESIDUE CLA A 1122 source : CC1 71) chain A residue 334 type sequence H description BINDING SITE FOR RESIDUE CLA A 1122 source : CC1 72) chain A residue 343 type sequence H description BINDING SITE FOR RESIDUE CLA A 1122 source : CC1 73) chain A residue 346 type sequence L description BINDING SITE FOR RESIDUE CLA A 1122 source : CC1 74) chain A residue 431 type sequence L description BINDING SITE FOR RESIDUE CLA A 1122 source : CC1 75) chain A residue 199 type sequence V description BINDING SITE FOR RESIDUE CLA A 1123 source : CC2 76) chain A residue 202 type sequence M description BINDING SITE FOR RESIDUE CLA A 1123 source : CC2 77) chain A residue 203 type sequence L description BINDING SITE FOR RESIDUE CLA A 1123 source : CC2 78) chain A residue 206 type sequence H description BINDING SITE FOR RESIDUE CLA A 1123 source : CC2 79) chain A residue 360 type sequence I description BINDING SITE FOR RESIDUE CLA A 1123 source : CC2 80) chain A residue 361 type sequence N description BINDING SITE FOR RESIDUE CLA A 1123 source : CC2 81) chain A residue 364 type sequence M description BINDING SITE FOR RESIDUE CLA A 1123 source : CC2 82) chain A residue 365 type sequence L description BINDING SITE FOR RESIDUE CLA A 1123 source : CC2 83) chain A residue 370 type sequence I description BINDING SITE FOR RESIDUE CLA A 1124 source : CC3 84) chain A residue 407 type sequence I description BINDING SITE FOR RESIDUE CLA A 1124 source : CC3 85) chain A residue 92 type sequence W description BINDING SITE FOR RESIDUE CLA A 1126 source : CC4 86) chain A residue 146 type sequence T description BINDING SITE FOR RESIDUE CLA A 1126 source : CC4 87) chain A residue 147 type sequence S description BINDING SITE FOR RESIDUE CLA A 1126 source : CC4 88) chain A residue 394 type sequence S description BINDING SITE FOR RESIDUE CLA A 1126 source : CC4 89) chain A residue 397 type sequence T description BINDING SITE FOR RESIDUE CLA A 1126 source : CC4 90) chain A residue 398 type sequence H description BINDING SITE FOR RESIDUE CLA A 1126 source : CC4 91) chain A residue 401 type sequence W description BINDING SITE FOR RESIDUE CLA A 1126 source : CC4 92) chain A residue 402 type sequence I description BINDING SITE FOR RESIDUE CLA A 1126 source : CC4 93) chain A residue 743 type sequence I description BINDING SITE FOR RESIDUE CLA A 1126 source : CC4 94) chain A residue 747 type sequence W description BINDING SITE FOR RESIDUE CLA A 1126 source : CC4 95) chain A residue 750 type sequence F description BINDING SITE FOR RESIDUE CLA A 1126 source : CC4 96) chain A residue 369 type sequence T description BINDING SITE FOR RESIDUE CLA A 1127 source : CC5 97) chain A residue 372 type sequence V description BINDING SITE FOR RESIDUE CLA A 1127 source : CC5 98) chain A residue 376 type sequence M description BINDING SITE FOR RESIDUE CLA A 1127 source : CC5 99) chain A residue 398 type sequence H description BINDING SITE FOR RESIDUE CLA A 1127 source : CC5 100) chain A residue 399 type sequence H description BINDING SITE FOR RESIDUE CLA A 1127 source : CC5 101) chain A residue 402 type sequence I description BINDING SITE FOR RESIDUE CLA A 1127 source : CC5 102) chain A residue 58 type sequence H description BINDING SITE FOR RESIDUE CLA A 1128 source : CC6 103) chain A residue 59 type sequence A description BINDING SITE FOR RESIDUE CLA A 1128 source : CC6 104) chain A residue 60 type sequence D description BINDING SITE FOR RESIDUE CLA A 1128 source : CC6 105) chain A residue 62 type sequence H description BINDING SITE FOR RESIDUE CLA A 1128 source : CC6 106) chain A residue 63 type sequence D description BINDING SITE FOR RESIDUE CLA A 1128 source : CC6 107) chain A residue 358 type sequence L description BINDING SITE FOR RESIDUE CLA A 1128 source : CC6 108) chain A residue 409 type sequence G description BINDING SITE FOR RESIDUE CLA A 1128 source : CC6 109) chain A residue 420 type sequence R description BINDING SITE FOR RESIDUE CLA A 1128 source : CC6 110) chain A residue 577 type sequence F description BINDING SITE FOR RESIDUE CLA A 1128 source : CC6 111) chain A residue 595 type sequence W description BINDING SITE FOR RESIDUE CLA A 1128 source : CC6 112) chain A residue 338 type sequence F description BINDING SITE FOR RESIDUE CLA A 1129 source : CC7 113) chain A residue 431 type sequence L description BINDING SITE FOR RESIDUE CLA A 1129 source : CC7 114) chain A residue 434 type sequence R description BINDING SITE FOR RESIDUE CLA A 1129 source : CC7 115) chain A residue 438 type sequence H description BINDING SITE FOR RESIDUE CLA A 1129 source : CC7 116) chain A residue 442 type sequence I description BINDING SITE FOR RESIDUE CLA A 1129 source : CC7 117) chain A residue 445 type sequence H description BINDING SITE FOR RESIDUE CLA A 1129 source : CC7 118) chain A residue 445 type sequence H description BINDING SITE FOR RESIDUE CLA L 1130 source : CC8 119) chain A residue 448 type sequence W description BINDING SITE FOR RESIDUE CLA L 1130 source : CC8 120) chain A residue 448 type sequence W description BINDING SITE FOR RESIDUE CLA A 1131 source : CC9 121) chain A residue 451 type sequence I description BINDING SITE FOR RESIDUE CLA A 1131 source : CC9 122) chain A residue 452 type sequence F description BINDING SITE FOR RESIDUE CLA A 1131 source : CC9 123) chain A residue 455 type sequence F description BINDING SITE FOR RESIDUE CLA A 1131 source : CC9 124) chain A residue 456 type sequence H description BINDING SITE FOR RESIDUE CLA A 1131 source : CC9 125) chain A residue 456 type sequence H description BINDING SITE FOR RESIDUE CLA A 1132 source : DC1 126) chain A residue 459 type sequence G description BINDING SITE FOR RESIDUE CLA A 1132 source : DC1 127) chain A residue 460 type sequence L description BINDING SITE FOR RESIDUE CLA A 1132 source : DC1 128) chain A residue 462 type sequence I description BINDING SITE FOR RESIDUE CLA A 1132 source : DC1 129) chain A residue 463 type sequence H description BINDING SITE FOR RESIDUE CLA A 1132 source : DC1 130) chain A residue 467 type sequence M description BINDING SITE FOR RESIDUE CLA A 1132 source : DC1 131) chain A residue 496 type sequence H description BINDING SITE FOR RESIDUE CLA A 1133 source : DC2 132) chain A residue 504 type sequence A description BINDING SITE FOR RESIDUE CLA A 1134 source : DC3 133) chain A residue 505 type sequence P description BINDING SITE FOR RESIDUE CLA A 1134 source : DC3 134) chain A residue 370 type sequence I description BINDING SITE FOR RESIDUE CLA A 1135 source : DC4 135) chain A residue 374 type sequence Q description BINDING SITE FOR RESIDUE CLA A 1135 source : DC4 136) chain A residue 377 type sequence Y description BINDING SITE FOR RESIDUE CLA A 1135 source : DC4 137) chain A residue 396 type sequence F description BINDING SITE FOR RESIDUE CLA A 1135 source : DC4 138) chain A residue 491 type sequence W description BINDING SITE FOR RESIDUE CLA A 1135 source : DC4 139) chain A residue 493 type sequence Q description BINDING SITE FOR RESIDUE CLA A 1135 source : DC4 140) chain A residue 496 type sequence H description BINDING SITE FOR RESIDUE CLA A 1135 source : DC4 141) chain A residue 532 type sequence I description BINDING SITE FOR RESIDUE CLA A 1135 source : DC4 142) chain A residue 542 type sequence H description BINDING SITE FOR RESIDUE CLA A 1135 source : DC4 143) chain A residue 616 type sequence F description BINDING SITE FOR RESIDUE CLA A 1135 source : DC4 144) chain A residue 452 type sequence F description BINDING SITE FOR RESIDUE CLA A 1136 source : DC5 145) chain A residue 453 type sequence L description BINDING SITE FOR RESIDUE CLA A 1136 source : DC5 146) chain A residue 488 type sequence F description BINDING SITE FOR RESIDUE CLA A 1136 source : DC5 147) chain A residue 538 type sequence D description BINDING SITE FOR RESIDUE CLA A 1136 source : DC5 148) chain A residue 543 type sequence H description BINDING SITE FOR RESIDUE CLA A 1136 source : DC5 149) chain A residue 546 type sequence A description BINDING SITE FOR RESIDUE CLA A 1136 source : DC5 150) chain A residue 446 type sequence L description BINDING SITE FOR RESIDUE CLA A 1137 source : DC6 151) chain A residue 549 type sequence I description BINDING SITE FOR RESIDUE CLA A 1137 source : DC6 152) chain A residue 550 type sequence H description BINDING SITE FOR RESIDUE CLA A 1137 source : DC6 153) chain A residue 707 type sequence I description BINDING SITE FOR RESIDUE CLA B 1138 source : DC7 154) chain A residue 710 type sequence A description BINDING SITE FOR RESIDUE CLA B 1138 source : DC7 155) chain A residue 51 type sequence T description BINDING SITE FOR RESIDUE CLA F 1139 source : DC8 156) chain A residue 55 type sequence W description BINDING SITE FOR RESIDUE CLA F 1139 source : DC8 157) chain A residue 704 type sequence I description BINDING SITE FOR RESIDUE CLA F 1139 source : DC8 158) chain A residue 711 type sequence H description BINDING SITE FOR RESIDUE CLA F 1139 source : DC8 159) chain A residue 722 type sequence P description BINDING SITE FOR RESIDUE CLA F 1139 source : DC8 160) chain A residue 55 type sequence W description BINDING SITE FOR RESIDUE CLA A 1140 source : DC9 161) chain A residue 684 type sequence F description BINDING SITE FOR RESIDUE CLA A 1140 source : DC9 162) chain A residue 685 type sequence V description BINDING SITE FOR RESIDUE CLA A 1140 source : DC9 163) chain A residue 688 type sequence F description BINDING SITE FOR RESIDUE CLA A 1140 source : DC9 164) chain A residue 692 type sequence F description BINDING SITE FOR RESIDUE CLA A 1140 source : DC9 165) chain A residue 725 type sequence L description BINDING SITE FOR RESIDUE CLA A 1140 source : DC9 166) chain A residue 732 type sequence A description BINDING SITE FOR RESIDUE CLA A 1140 source : DC9 167) chain A residue 733 type sequence V description BINDING SITE FOR RESIDUE CLA A 1140 source : DC9 168) chain A residue 736 type sequence T description BINDING SITE FOR RESIDUE CLA A 1140 source : DC9 169) chain A residue 737 type sequence H description BINDING SITE FOR RESIDUE CLA A 1140 source : DC9 170) chain A residue 269 type sequence F description BINDING SITE FOR RESIDUE CLA A 1143 source : EC2 171) chain A residue 270 type sequence F description BINDING SITE FOR RESIDUE CLA A 1143 source : EC2 172) chain A residue 210 type sequence L description BINDING SITE FOR RESIDUE CLA A 1146 source : EC3 173) chain A residue 213 type sequence L description BINDING SITE FOR RESIDUE CLA A 1146 source : EC3 174) chain A residue 166 type sequence C description BINDING SITE FOR RESIDUE CLA A 1147 source : EC4 175) chain A residue 246 type sequence H description BINDING SITE FOR RESIDUE CLA A 1147 source : EC4 176) chain A residue 217 type sequence S description BINDING SITE FOR RESIDUE CLA A 1148 source : EC5 177) chain A residue 218 type sequence W description BINDING SITE FOR RESIDUE CLA A 1148 source : EC5 178) chain A residue 221 type sequence H description BINDING SITE FOR RESIDUE CLA A 1148 source : EC5 179) chain A residue 225 type sequence V description BINDING SITE FOR RESIDUE CLA A 1148 source : EC5 180) chain A residue 653 type sequence L description BINDING SITE FOR RESIDUE CLA B 9010 source : EC7 181) chain A residue 657 type sequence L description BINDING SITE FOR RESIDUE CLA B 9010 source : EC7 182) chain A residue 606 type sequence Y description BINDING SITE FOR RESIDUE CLA A 9011 source : EC8 183) chain A residue 607 type sequence N description BINDING SITE FOR RESIDUE CLA A 9011 source : EC8 184) chain A residue 610 type sequence S description BINDING SITE FOR RESIDUE CLA A 9011 source : EC8 185) chain A residue 652 type sequence W description BINDING SITE FOR RESIDUE CLA A 9011 source : EC8 186) chain A residue 661 type sequence A description BINDING SITE FOR RESIDUE CLA A 9011 source : EC8 187) chain A residue 665 type sequence I description BINDING SITE FOR RESIDUE CLA A 9011 source : EC8 188) chain A residue 683 type sequence H description BINDING SITE FOR RESIDUE CLA A 9011 source : EC8 189) chain A residue 686 type sequence W description BINDING SITE FOR RESIDUE CLA A 9011 source : EC8 190) chain A residue 738 type sequence Y description BINDING SITE FOR RESIDUE CLA A 9011 source : EC8 191) chain A residue 742 type sequence G description BINDING SITE FOR RESIDUE CLA A 9011 source : EC8 192) chain A residue 745 type sequence T description BINDING SITE FOR RESIDUE CLA A 9011 source : EC8 193) chain A residue 746 type sequence T description BINDING SITE FOR RESIDUE CLA A 9011 source : EC8 194) chain A residue 749 type sequence F description BINDING SITE FOR RESIDUE CLA A 9011 source : EC8 195) chain A residue 677 type sequence L description BINDING SITE FOR RESIDUE CLA B 9012 source : EC9 196) chain A residue 680 type sequence L description BINDING SITE FOR RESIDUE CLA B 9012 source : EC9 197) chain A residue 681 type sequence G description BINDING SITE FOR RESIDUE CLA B 9012 source : EC9 198) chain A residue 684 type sequence F description BINDING SITE FOR RESIDUE CLA B 9012 source : EC9 199) chain A residue 684 type sequence F description BINDING SITE FOR RESIDUE CLA A 9013 source : FC1 200) chain A residue 687 type sequence A description BINDING SITE FOR RESIDUE CLA A 9013 source : FC1 201) chain A residue 688 type sequence F description BINDING SITE FOR RESIDUE CLA A 9013 source : FC1 202) chain A residue 690 type sequence L description BINDING SITE FOR RESIDUE CLA A 9013 source : FC1 203) chain A residue 691 type sequence M description BINDING SITE FOR RESIDUE CLA A 9013 source : FC1 204) chain A residue 694 type sequence F description BINDING SITE FOR RESIDUE CLA A 9013 source : FC1 205) chain A residue 700 type sequence W description BINDING SITE FOR RESIDUE CLA A 9013 source : FC1 206) chain A residue 458 type sequence F description BINDING SITE FOR RESIDUE CLA B 9022 source : FC2 207) chain A residue 462 type sequence I description BINDING SITE FOR RESIDUE CLA B 9022 source : FC2 208) chain A residue 604 type sequence W description BINDING SITE FOR RESIDUE CLA B 9022 source : FC2 209) chain A residue 607 type sequence N description BINDING SITE FOR RESIDUE CLA B 9022 source : FC2 210) chain A residue 649 type sequence I description BINDING SITE FOR RESIDUE CLA B 9022 source : FC2 211) chain A residue 738 type sequence Y description BINDING SITE FOR RESIDUE CLA B 9022 source : FC2 212) chain A residue 447 type sequence N description BINDING SITE FOR RESIDUE CLA B 9023 source : FC3 213) chain A residue 450 type sequence C description BINDING SITE FOR RESIDUE CLA B 9023 source : FC3 214) chain A residue 455 type sequence F description BINDING SITE FOR RESIDUE CLA B 9023 source : FC3 215) chain A residue 555 type sequence I description BINDING SITE FOR RESIDUE CLA B 9023 source : FC3 216) chain A residue 600 type sequence L description BINDING SITE FOR RESIDUE CLA B 9023 source : FC3 217) chain A residue 603 type sequence F description BINDING SITE FOR RESIDUE CLA B 9023 source : FC3 218) chain A residue 604 type sequence W description BINDING SITE FOR RESIDUE CLA B 9023 source : FC3 219) chain A residue 466 type sequence T description BINDING SITE FOR RESIDUE CLA B 1206 source : FC9 220) chain A residue 470 type sequence L description BINDING SITE FOR RESIDUE CLA B 1206 source : FC9 221) chain A residue 709 type sequence W description BINDING SITE FOR RESIDUE CLA B 1228 source : IC4 222) chain A residue 444 type sequence S description BINDING SITE FOR RESIDUE CLA B 1237 source : JC4 223) chain A residue 447 type sequence N description BINDING SITE FOR RESIDUE CLA B 1237 source : JC4 224) chain A residue 451 type sequence I description BINDING SITE FOR RESIDUE CLA B 1237 source : JC4 225) chain A residue 581 type sequence C description BINDING SITE FOR RESIDUE SF4 B 3101 source : QC9 226) chain A residue 582 type sequence D description BINDING SITE FOR RESIDUE SF4 B 3101 source : QC9 227) chain A residue 590 type sequence C description BINDING SITE FOR RESIDUE SF4 B 3101 source : QC9 228) chain A residue 55 type sequence W description BINDING SITE FOR RESIDUE PQN A 5001 source : RC3 229) chain A residue 691 type sequence M description BINDING SITE FOR RESIDUE PQN A 5001 source : RC3 230) chain A residue 692 type sequence F description BINDING SITE FOR RESIDUE PQN A 5001 source : RC3 231) chain A residue 695 type sequence S description BINDING SITE FOR RESIDUE PQN A 5001 source : RC3 232) chain A residue 696 type sequence G description BINDING SITE FOR RESIDUE PQN A 5001 source : RC3 233) chain A residue 700 type sequence W description BINDING SITE FOR RESIDUE PQN A 5001 source : RC3 234) chain A residue 724 type sequence A description BINDING SITE FOR RESIDUE PQN A 5001 source : RC3 235) chain A residue 725 type sequence L description BINDING SITE FOR RESIDUE PQN A 5001 source : RC3 236) chain A residue 681 type sequence G description BINDING SITE FOR RESIDUE BCR A 6011 source : RC5 237) chain A residue 684 type sequence F description BINDING SITE FOR RESIDUE BCR A 6011 source : RC5 238) chain A residue 744 type sequence A description BINDING SITE FOR RESIDUE BCR A 6011 source : RC5 239) chain A residue 747 type sequence W description BINDING SITE FOR RESIDUE BCR A 6011 source : RC5 240) chain A residue 581-590 type prosite sequence CDGPGRGGTC description PHOTOSYSTEM_I_PSAAB Photosystem I psaA and psaB proteins signature. CDGPGRGGTC source prosite : PS00419

Display surface Download Links