eF-site ID 2o01-4 PDB Code 2o01 Chain 4 click to enlarge Title The Structure of a plant photosystem I supercomplex at 3.4 Angstrom resolution Classification PHOTOSYNTHESIS Compound Photosystem I P700 chlorophyll a apoprotein A1 Source ORGANISM_COMMON: pea; ORGANISM_SCIENTIFIC: Pisum sativum; Sequence 4:  PENLRWFVQAELVNGRWAMLGVAGMLLPEVFTSIGIINVP KWYAAGKEEYFASSSTLFVIEFILSHYVEIRRWQDIKNPG SVNQDPIFKQYSLPAGEVGYPGGIFNPLNFAPTLEAKEKE IANGRLAMLAFLGFIIQHNVTGKGPFDNLLQHISDPWHNT IVQTL Description Functional site 1) chain 4 residue 103 type sequence I description BINDING SITE FOR RESIDUE CLA 4 1304 source : KC4 2) chain 4 residue 106 type sequence W description BINDING SITE FOR RESIDUE CLA 4 1304 source : KC4 3) chain 4 residue 147 type sequence L description BINDING SITE FOR RESIDUE CLA 4 4009 source : PC5 4) chain 4 residue 44 type sequence E description BINDING SITE FOR RESIDUE CLA 4 4004 source : PC6 5) chain 4 residue 154 type sequence I description BINDING SITE FOR RESIDUE CLA 4 4004 source : PC6 6) chain 4 residue 155 type sequence A description BINDING SITE FOR RESIDUE CLA 4 4004 source : PC6 7) chain 4 residue 158 type sequence R description BINDING SITE FOR RESIDUE CLA 4 4004 source : PC6 8) chain 4 residue 47 type sequence N description BINDING SITE FOR RESIDUE CLA 4 4005 source : PC7 9) chain 4 residue 164 type sequence F description BINDING SITE FOR RESIDUE CLA 4 4005 source : PC7 10) chain 4 residue 57 type sequence G description BINDING SITE FOR RESIDUE CLA 4 4006 source : PC8 11) chain 4 residue 60 type sequence L description BINDING SITE FOR RESIDUE CLA 4 4006 source : PC8 12) chain 4 residue 76 type sequence Y description BINDING SITE FOR RESIDUE CLA 4 4006 source : PC8 13) chain 4 residue 90 type sequence L description BINDING SITE FOR RESIDUE CLA 4 4013 source : PC9 14) chain 4 residue 95 type sequence F description BINDING SITE FOR RESIDUE CLA 4 4013 source : PC9 15) chain 4 residue 42 type sequence Q description BINDING SITE FOR RESIDUE CLA 4 4011 source : QC2 16) chain 4 residue 49 type sequence R description BINDING SITE FOR RESIDUE CLA 4 4011 source : QC2 17) chain 4 residue 105 type sequence R description BINDING SITE FOR RESIDUE CLA 4 4011 source : QC2 18) chain 4 residue 108 type sequence D description BINDING SITE FOR RESIDUE CLA 4 4011 source : QC2 19) chain 4 residue 114 type sequence S description BINDING SITE FOR RESIDUE CLA 4 4011 source : QC2 20) chain 4 residue 119 type sequence P description BINDING SITE FOR RESIDUE CLA 4 4011 source : QC2 21) chain 4 residue 43 type sequence A description BINDING SITE FOR RESIDUE CLA 4 4012 source : QC3 22) chain 4 residue 46 type sequence V description BINDING SITE FOR RESIDUE CLA 4 4012 source : QC3 23) chain 4 residue 50 type sequence W description BINDING SITE FOR RESIDUE CLA 4 4012 source : QC3 24) chain 4 residue 102 type sequence E description BINDING SITE FOR RESIDUE CLA 4 4012 source : QC3 25) chain 4 residue 106 type sequence W description BINDING SITE FOR RESIDUE CLA 4 4012 source : QC3 26) chain 4 residue 49 type sequence R description BINDING SITE FOR RESIDUE CLA 4 4001 source : QC4 27) chain 4 residue 52 type sequence M description BINDING SITE FOR RESIDUE CLA 4 4001 source : QC4 28) chain 4 residue 53 type sequence L description BINDING SITE FOR RESIDUE CLA 4 4001 source : QC4 29) chain 4 residue 118 type sequence D description BINDING SITE FOR RESIDUE CLA 4 4001 source : QC4 30) chain 4 residue 151 type sequence E description BINDING SITE FOR RESIDUE CLA 4 4007 source : QC5 31) chain 4 residue 156 type sequence N description BINDING SITE FOR RESIDUE CLA 4 4002 source : QC6 32) chain 4 residue 159 type sequence L description BINDING SITE FOR RESIDUE CLA 4 4002 source : QC6 33) chain 4 residue 162 type sequence L description BINDING SITE FOR RESIDUE CLA 4 4003 source : QC7 34) chain 4 residue 167 type sequence F description BINDING SITE FOR RESIDUE CLA 4 4003 source : QC7 35) chain 4 residue 170 type sequence Q description BINDING SITE FOR RESIDUE CLA 4 4003 source : QC7 36) chain 4 residue 185 type sequence H description BINDING SITE FOR RESIDUE CLA 4 4008 source : QC8 37) chain 4 residue 186 type sequence I description BINDING SITE FOR RESIDUE CLA 4 4008 source : QC8 38) chain 4 residue 50-70 type TRANSMEM sequence WAMLGVAGMLLPEVFTSIGII description Helical => ECO:0000255 source Swiss-Prot : SWS_FT_FI1 39) chain 4 residue 83-103 type TRANSMEM sequence YFASSSTLFVIEFILSHYVEI description Helical => ECO:0000255 source Swiss-Prot : SWS_FT_FI1 40) chain 4 residue 44 type BINDING sequence E description axial binding residue => ECO:0000250|UniProtKB:P07371 source Swiss-Prot : SWS_FT_FI2 41) chain 4 residue 153 type BINDING sequence E description axial binding residue => ECO:0000250|UniProtKB:P07371 source Swiss-Prot : SWS_FT_FI2 42) chain 4 residue 156 type BINDING sequence N description axial binding residue => ECO:0000250|UniProtKB:P07371 source Swiss-Prot : SWS_FT_FI2 43) chain 4 residue 170 type BINDING sequence Q description axial binding residue => ECO:0000250|UniProtKB:P07371 source Swiss-Prot : SWS_FT_FI2 44) chain 4 residue 185 type BINDING sequence H description axial binding residue => ECO:0000250|UniProtKB:P07371 source Swiss-Prot : SWS_FT_FI2 45) chain 4 residue 49 type BINDING sequence R description BINDING => ECO:0000250|UniProtKB:P07371 source Swiss-Prot : SWS_FT_FI3 46) chain 4 residue 152 type BINDING sequence K description BINDING => ECO:0000250|UniProtKB:P07371 source Swiss-Prot : SWS_FT_FI3 47) chain 4 residue 158 type BINDING sequence R description BINDING => ECO:0000250|UniProtKB:P07371 source Swiss-Prot : SWS_FT_FI3 48) chain 4 residue 86 type BINDING sequence S description BINDING => ECO:0000250|UniProtKB:P27521 source Swiss-Prot : SWS_FT_FI4 49) chain 4 residue 105 type BINDING sequence R description BINDING => ECO:0000250|UniProtKB:P27521 source Swiss-Prot : SWS_FT_FI4 50) chain 4 residue 92 type BINDING sequence V description axial binding residue => ECO:0000250 source Swiss-Prot : SWS_FT_FI5 51) chain 4 residue 102 type BINDING sequence E description axial binding residue => ECO:0000250|UniProtKB:P27521 source Swiss-Prot : SWS_FT_FI6

Display surface Download Links