eF-site ID 2o01-3 PDB Code 2o01 Chain 3 click to enlarge Title The Structure of a plant photosystem I supercomplex at 3.4 Angstrom resolution Classification PHOTOSYNTHESIS Compound Photosystem I P700 chlorophyll a apoprotein A1 Source ORGANISM_COMMON: pea; ORGANISM_SCIENTIFIC: Pisum sativum; Sequence 3:  WLAYGEIINGRFAMLGAAGAIAPEILGKAGLIPAETTYTY WADNYTLFVLEMALMGFAEHRRLQDWYNPGSMGKQYFLGK EVKNGRLAMLAILGYFIQGLVTGVGPYQNLLDHLA Description Functional site 1) chain 3 residue 185 type sequence V description BINDING SITE FOR RESIDUE CLA 3 3004 source : OC3 2) chain 3 residue 186 type sequence K description BINDING SITE FOR RESIDUE CLA 3 3004 source : OC3 3) chain 3 residue 67 type sequence M description BINDING SITE FOR RESIDUE CLA 3 3005 source : OC4 4) chain 3 residue 196 type sequence L description BINDING SITE FOR RESIDUE CLA 3 3005 source : OC4 5) chain 3 residue 199 type sequence F description BINDING SITE FOR RESIDUE CLA 3 3005 source : OC4 6) chain 3 residue 73 type sequence A description BINDING SITE FOR RESIDUE CLA 3 3006 source : OC6 7) chain 3 residue 77 type sequence E description BINDING SITE FOR RESIDUE CLA 3 3006 source : OC6 8) chain 3 residue 80 type sequence G description BINDING SITE FOR RESIDUE CLA 3 3006 source : OC6 9) chain 3 residue 81 type sequence K description BINDING SITE FOR RESIDUE CLA 3 3006 source : OC6 10) chain 3 residue 110 type sequence D description BINDING SITE FOR RESIDUE CLA 3 3013 source : OC7 11) chain 3 residue 118 type sequence E description BINDING SITE FOR RESIDUE CLA 3 3013 source : OC7 12) chain 3 residue 116 type sequence V description BINDING SITE FOR RESIDUE CLA 3 3010 source : OC8 13) chain 3 residue 119 type sequence M description BINDING SITE FOR RESIDUE CLA 3 3010 source : OC8 14) chain 3 residue 65 type sequence F description BINDING SITE FOR RESIDUE CLA 3 3001 source : OC9 15) chain 3 residue 68 type sequence L description BINDING SITE FOR RESIDUE CLA 3 3001 source : OC9 16) chain 3 residue 64 type sequence R description BINDING SITE FOR RESIDUE CLA 3 3002 source : PC2 17) chain 3 residue 198 type sequence Y description BINDING SITE FOR RESIDUE CLA 3 3003 source : PC4 18) chain 3 residue 201 type sequence Q description BINDING SITE FOR RESIDUE CLA 3 3003 source : PC4 19) chain 3 residue 190-210 type TRANSMEM sequence LAMLAILGYFIQGLVTGVGPY description Helical => ECO:0000255 source Swiss-Prot : SWS_FT_FI1 20) chain 3 residue 201 type BINDING sequence Q description axial binding residue => ECO:0000250|UniProtKB:P07371 source Swiss-Prot : SWS_FT_FI2 21) chain 3 residue 216 type BINDING sequence H description axial binding residue => ECO:0000250|UniProtKB:P07371 source Swiss-Prot : SWS_FT_FI2 22) chain 3 residue 189 type BINDING sequence R description BINDING => ECO:0000250|UniProtKB:P07371 source Swiss-Prot : SWS_FT_FI3

Display surface Download Links