eF-site ID 2nnp-B PDB Code 2nnp Chain B click to enlarge Title Crystal structure analysis of HIV-1 protease mutant I84V with a inhibitor saquinavir Classification HYDROLASE/HYDROLASE INHIBITOR Compound PROTEASE Source Human immunodeficiency virus type 1 group M subtype B (isolate BH5) (HIV-1) (POL_HV1B5) Sequence B:  PQITLWKRPLVTIKIGGQLKEALLDTGADDTVIEEMSLPG RWKPKMIGGIGGFIKVRQYDQIIIEIAGHKAIGTVLVGPT PVNVIGRNLLTQIGATLNF Description Functional site 1) chain B residue 101 type sequence P description BINDING SITE FOR RESIDUE SO4 B 603 source : AC1 2) chain B residue 157 type sequence R description BINDING SITE FOR RESIDUE SO4 B 603 source : AC1 3) chain B residue 169 type sequence H description BINDING SITE FOR RESIDUE SO4 B 603 source : AC1 4) chain B residue 108 type sequence R description BINDING SITE FOR RESIDUE ROC A 401 source : AC2 5) chain B residue 125 type sequence D description BINDING SITE FOR RESIDUE ROC A 401 source : AC2 6) chain B residue 127 type sequence G description BINDING SITE FOR RESIDUE ROC A 401 source : AC2 7) chain B residue 148 type sequence G description BINDING SITE FOR RESIDUE ROC A 401 source : AC2 8) chain B residue 150 type sequence I description BINDING SITE FOR RESIDUE ROC A 401 source : AC2 9) chain B residue 181 type sequence P description BINDING SITE FOR RESIDUE ROC A 401 source : AC2 10) chain B residue 136 type sequence M description BINDING SITE FOR RESIDUE ACY B 602 source : AC4 11) chain B residue 137 type sequence S description BINDING SITE FOR RESIDUE ACY B 602 source : AC4 12) chain B residue 129 type sequence D description BINDING SITE FOR RESIDUE GOL A 604 source : AC5 13) chain B residue 187 type sequence R description BINDING SITE FOR RESIDUE GOL A 604 source : AC5 14) chain B residue 169 type sequence H description BINDING SITE FOR RESIDUE GOL A 605 source : AC6 15) chain B residue 170 type sequence K description BINDING SITE FOR RESIDUE GOL A 605 source : AC6 16) chain B residue 199 type sequence F description BINDING SITE FOR RESIDUE GOL A 605 source : AC6 17) chain B residue 101 type SITE sequence P description Cleavage; by viral protease => ECO:0000250 source Swiss-Prot : SWS_FT_FI2 18) chain B residue 126 type ACT_SITE sequence T description For protease activity; shared with dimeric partner => ECO:0000255|PROSITE-ProRule:PRU10094 source Swiss-Prot : SWS_FT_FI1

Display surface Download Links