eF-site ID 2nnp-A PDB Code 2nnp Chain A click to enlarge Title Crystal structure analysis of HIV-1 protease mutant I84V with a inhibitor saquinavir Classification HYDROLASE/HYDROLASE INHIBITOR Compound PROTEASE Source Human immunodeficiency virus type 1 group M subtype B (isolate BH5) (HIV-1) (POL_HV1B5) Sequence A:  PQITLWKRPLVTIKIGGQLKEALLDTGADDTVIEEMSLPG RWKPKMIGGIGGFIKVRQYDQIIIEIAGHKAIGTVLVGPT PVNVIGRNLLTQIGATLNF Description Functional site 1) chain A residue 6 type sequence W description BINDING SITE FOR RESIDUE ROC A 401 source : AC2 2) chain A residue 25 type sequence D description BINDING SITE FOR RESIDUE ROC A 401 source : AC2 3) chain A residue 27 type sequence G description BINDING SITE FOR RESIDUE ROC A 401 source : AC2 4) chain A residue 29 type sequence D description BINDING SITE FOR RESIDUE ROC A 401 source : AC2 5) chain A residue 30 type sequence D description BINDING SITE FOR RESIDUE ROC A 401 source : AC2 6) chain A residue 48 type sequence G description BINDING SITE FOR RESIDUE ROC A 401 source : AC2 7) chain A residue 50 type sequence I description BINDING SITE FOR RESIDUE ROC A 401 source : AC2 8) chain A residue 7 type sequence K description BINDING SITE FOR RESIDUE ACY A 601 source : AC3 9) chain A residue 8 type sequence R description BINDING SITE FOR RESIDUE ACY A 601 source : AC3 10) chain A residue 39 type sequence P description BINDING SITE FOR RESIDUE ACY B 602 source : AC4 11) chain A residue 40 type sequence G description BINDING SITE FOR RESIDUE ACY B 602 source : AC4 12) chain A residue 5 type sequence L description BINDING SITE FOR RESIDUE GOL A 604 source : AC5 13) chain A residue 6 type sequence W description BINDING SITE FOR RESIDUE GOL A 604 source : AC5 14) chain A residue 1 type sequence P description BINDING SITE FOR RESIDUE GOL A 605 source : AC6 15) chain A residue 55 type sequence K description BINDING SITE FOR RESIDUE GOL A 605 source : AC6 16) chain A residue 22-33 type prosite sequence ALLDTGADDTVI description ASP_PROTEASE Eukaryotic and viral aspartyl proteases active site. ALLDTGADDTVI source prosite : PS00141 17) chain A residue 26 type ACT_SITE sequence T description For protease activity; shared with dimeric partner => ECO:0000255|PROSITE-ProRule:PRU10094 source Swiss-Prot : SWS_FT_FI1 18) chain A residue 1 type SITE sequence P description Cleavage; by viral protease => ECO:0000250 source Swiss-Prot : SWS_FT_FI2

Display surface Download Links