eF-site ID 2nlu_12-AB
PDB Code 2nlu
Model 12
Chain A, B

click to enlarge
Title Domain-Swapped Dimer of the PWWP Module of Human Hepatoma-derived Growth Factor
Classification HORMONE/GROWTH FACTOR
Compound Hepatoma-derived growth factor
Source Homo sapiens (Human) (HDGF_HUMAN)
Sequence A:  MSRSNRQKEYKCGDLVFAKMKGYPHWPARIDEMPEAAVKS
TANKYQVFFFGTHETAFLGPKDLFPYEESKEKFGKPNKRK
GFSEGLWEIENNPTVKASGY
B:  MSRSNRQKEYKCGDLVFAKMKGYPHWPARIDEMPEAAVKS
TANKYQVFFFGTHETAFLGPKDLFPYEESKEKFGKPNKRK
GFSEGLWEIENNPTVKASGY
Description (1)  Hepatoma-derived growth factor


Functional site

1) chain A
residue 19
type BINDING
ligand
sequence K
description Heparin (Probable).
source Swiss-Prot : SWS_FT_FI1

2) chain A
residue 21
type BINDING
ligand
sequence K
description Heparin (Probable).
source Swiss-Prot : SWS_FT_FI1

3) chain A
residue 72
type BINDING
ligand
sequence K
description Heparin (Probable).
source Swiss-Prot : SWS_FT_FI1

4) chain A
residue 75
type BINDING
ligand
sequence K
description Heparin (Probable).
source Swiss-Prot : SWS_FT_FI1

5) chain A
residue 79
type BINDING
ligand
sequence R
description Heparin (Probable).
source Swiss-Prot : SWS_FT_FI1

6) chain A
residue 80
type BINDING
ligand
sequence K
description Heparin (Probable).
source Swiss-Prot : SWS_FT_FI1


Display surface

Download
Links