eF-site ID 2n5h_16-A
PDB Code 2n5h
Model 16
Chain A

click to enlarge
Title PltL-holo
Classification TRANSPORT PROTEIN
Compound Peptidyl carrier protein PltL
Source Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) (Q4KCZ1_PSEF5)
Sequence A:  MDGEEVKEKIRRYIMEDLIGPSAKEDELDDQTPLLEWGIL
NSMNIVKLMVYIRDEMGVSIPSTHITGKYFKDLNAISRTV
EQLKAESALE
Description (1)  Peptidyl carrier protein PltL


Functional site

1) chain A
residue 42
type
ligand
sequence S
description BINDING SITE FOR RESIDUE PNS A 101
source : AC1

2) chain A
residue 45
type
ligand
sequence I
description BINDING SITE FOR RESIDUE PNS A 101
source : AC1

3) chain A
residue 46
type
ligand
sequence V
description BINDING SITE FOR RESIDUE PNS A 101
source : AC1

4) chain A
residue 65
type
ligand
sequence I
description BINDING SITE FOR RESIDUE PNS A 101
source : AC1

5) chain A
residue 66
type
ligand
sequence T
description BINDING SITE FOR RESIDUE PNS A 101
source : AC1

6) chain A
residue 67
type
ligand
sequence G
description BINDING SITE FOR RESIDUE PNS A 101
source : AC1

7) chain A
residue 35
type binding
ligand PNS: 4'-PHOSPHOPANTETHEINE
sequence L
description 4'-PHOSPHOPANTETHEINE binding site
source pdb_hetatom : PNS_2n5h_A_101

8) chain A
residue 38
type binding
ligand PNS: 4'-PHOSPHOPANTETHEINE
sequence G
description 4'-PHOSPHOPANTETHEINE binding site
source pdb_hetatom : PNS_2n5h_A_101

9) chain A
residue 40-43
type binding
ligand PNS: 4'-PHOSPHOPANTETHEINE
sequence LNSM
description 4'-PHOSPHOPANTETHEINE binding site
source pdb_hetatom : PNS_2n5h_A_101

10) chain A
residue 45-46
type binding
ligand PNS: 4'-PHOSPHOPANTETHEINE
sequence IV
description 4'-PHOSPHOPANTETHEINE binding site
source pdb_hetatom : PNS_2n5h_A_101

11) chain A
residue 49
type binding
ligand PNS: 4'-PHOSPHOPANTETHEINE
sequence M
description 4'-PHOSPHOPANTETHEINE binding site
source pdb_hetatom : PNS_2n5h_A_101

12) chain A
residue 62-63
type binding
ligand PNS: 4'-PHOSPHOPANTETHEINE
sequence ST
description 4'-PHOSPHOPANTETHEINE binding site
source pdb_hetatom : PNS_2n5h_A_101

13) chain A
residue 65-68
type binding
ligand PNS: 4'-PHOSPHOPANTETHEINE
sequence ITGK
description 4'-PHOSPHOPANTETHEINE binding site
source pdb_hetatom : PNS_2n5h_A_101

14) chain A
residue 70
type binding
ligand PNS: 4'-PHOSPHOPANTETHEINE
sequence F
description 4'-PHOSPHOPANTETHEINE binding site
source pdb_hetatom : PNS_2n5h_A_101

15) chain A
residue 44
type binding
ligand PNS: 4'-PHOSPHOPANTETHEINE
sequence N
description 4'-PHOSPHOPANTETHEINE binding site
source pdb_hetatom : PNS_2n5h_A_101

16) chain A
residue 48
type binding
ligand PNS: 4'-PHOSPHOPANTETHEINE
sequence L
description 4'-PHOSPHOPANTETHEINE binding site
source pdb_hetatom : PNS_2n5h_A_101

17) chain A
residue 64
type binding
ligand PNS: 4'-PHOSPHOPANTETHEINE
sequence H
description 4'-PHOSPHOPANTETHEINE binding site
source pdb_hetatom : PNS_2n5h_A_101

18) chain A
residue 76
type binding
ligand PNS: 4'-PHOSPHOPANTETHEINE
sequence I
description 4'-PHOSPHOPANTETHEINE binding site
source pdb_hetatom : PNS_2n5h_A_101

19) chain A
residue 69
type binding
ligand PNS: 4'-PHOSPHOPANTETHEINE
sequence Y
description 4'-PHOSPHOPANTETHEINE binding site
source pdb_hetatom : PNS_2n5h_A_101

20) chain A
residue 71
type binding
ligand PNS: 4'-PHOSPHOPANTETHEINE
sequence K
description 4'-PHOSPHOPANTETHEINE binding site
source pdb_hetatom : PNS_2n5h_A_101


Display surface

Download
Links