eF-site ID 2n5h_12-A
PDB Code 2n5h
Model 12
Chain A

click to enlarge
Title PltL-holo
Classification TRANSPORT PROTEIN
Compound Peptidyl carrier protein PltL
Source Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) (Q4KCZ1_PSEF5)
Sequence A:  MDGEEVKEKIRRYIMEDLIGPSAKEDELDDQTPLLEWGIL
NSMNIVKLMVYIRDEMGVSIPSTHITGKYFKDLNAISRTV
EQLKAESALE
Description (1)  Peptidyl carrier protein PltL


Functional site

1) chain A
residue 42
type
ligand
sequence S
description BINDING SITE FOR RESIDUE PNS A 101
source : AC1

2) chain A
residue 45
type
ligand
sequence I
description BINDING SITE FOR RESIDUE PNS A 101
source : AC1

3) chain A
residue 46
type
ligand
sequence V
description BINDING SITE FOR RESIDUE PNS A 101
source : AC1

4) chain A
residue 65
type
ligand
sequence I
description BINDING SITE FOR RESIDUE PNS A 101
source : AC1

5) chain A
residue 66
type
ligand
sequence T
description BINDING SITE FOR RESIDUE PNS A 101
source : AC1

6) chain A
residue 67
type
ligand
sequence G
description BINDING SITE FOR RESIDUE PNS A 101
source : AC1


Display surface

Download
Links