eF-site ID 2n59_19-A
PDB Code 2n59
Model 19
Chain A

click to enlarge
Title Solution Structure of R. palustris CsgH
Classification UNKNOWN FUNCTION
Compound Putative uncharacterized protein CsgH
Source Rhodopseudomonas palustris (strain DX-1) (E6VF87_RHOPX)
Sequence A:  MVQCEVEAAVSGGHVTLQGVITAVRDGAGSYKLAVDKAGA
AGTSRIKQAGAFTAIAEQRVTVGNVVLDYSSANRYAARLD
VSFGSVTIQCNLDPETVKLEH
Description (1)  Putative uncharacterized protein CsgH

Display surface

Download
Links