eF-site ID 2n28-A PDB Code 2n28 Chain A click to enlarge Title Solid-state NMR structure of Vpu Classification VIRAL PROTEIN Compound Protein Vpu Source Human immunodeficiency virus type 1 group M subtype B (isolate HXB3) (HIV-1) (VPU_HV1H3) Sequence A:  MQPIQIAIVALVVAIIIAIVVWSIVIIEYRKILRQRKIDR LIDRLIERAEDSGNESEGEISALVELGVELGHHAPWDVDD L Description (1)  Protein Vpu Functional site 1) chain A residue 52 type MOD_RES sequence S description Phosphoserine; by host CK2 => ECO:0000255|HAMAP-Rule:MF_04082 source Swiss-Prot : SWS_FT_FI4 2) chain A residue 56 type MOD_RES sequence S description Phosphoserine; by host CK2 => ECO:0000255|HAMAP-Rule:MF_04082 source Swiss-Prot : SWS_FT_FI4 3) chain A residue 1-6 type TOPO_DOM sequence MQPIQI description Extracellular => ECO:0000255|HAMAP-Rule:MF_04082 source Swiss-Prot : SWS_FT_FI1 4) chain A residue 7-27 type TRANSMEM sequence AIVALVVAIIIAIVVWSIVII description Helical => ECO:0000255|HAMAP-Rule:MF_04082 source Swiss-Prot : SWS_FT_FI2 5) chain A residue 28-81 type TOPO_DOM sequence EYRKILRQRKIDRLIDRLIERAEDSGNESEGEISALVELG VELGHHAPWDVDDL description Cytoplasmic => ECO:0000255|HAMAP-Rule:MF_04082 source Swiss-Prot : SWS_FT_FI3

Display surface Download Links