eF-site ID 2mwx_10-A PDB Code 2mwx Model 10 Chain A click to enlarge Title The RING Domain of human Promyelocytic Leukemia Protein (PML) Classification LIGASE Compound Protein PML Source null (PML_HUMAN) Sequence A:  EEEFQFLRCQQCQAEAKCPKLLPCLHTLCSGCLEASGMQC PICQAPWPLGADTPAL Description Functional site 1) chain A residue 57 type sequence C description BINDING SITE FOR RESIDUE ZN A 201 source : AC1 2) chain A residue 59 type sequence Q description BINDING SITE FOR RESIDUE ZN A 201 source : AC1 3) chain A residue 60 type sequence C description BINDING SITE FOR RESIDUE ZN A 201 source : AC1 4) chain A residue 77 type sequence C description BINDING SITE FOR RESIDUE ZN A 201 source : AC1 5) chain A residue 80 type sequence C description BINDING SITE FOR RESIDUE ZN A 201 source : AC1 6) chain A residue 72 type sequence C description BINDING SITE FOR RESIDUE ZN A 202 source : AC2 7) chain A residue 74 type sequence H description BINDING SITE FOR RESIDUE ZN A 202 source : AC2 8) chain A residue 88 type sequence C description BINDING SITE FOR RESIDUE ZN A 202 source : AC2 9) chain A residue 91 type sequence C description BINDING SITE FOR RESIDUE ZN A 202 source : AC2 10) chain A residue 57-92 type ZN_FING sequence CQQCQAEAKCPKLLPCLHTLCSGCLEASGMQCPICQ description RING-type => ECO:0000255|PROSITE-ProRule:PRU00175 source Swiss-Prot : SWS_FT_FI1 11) chain A residue 57 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI2 12) chain A residue 60 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI2 13) chain A residue 72 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI2 14) chain A residue 74 type BINDING sequence H description source Swiss-Prot : SWS_FT_FI2 15) chain A residue 77 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI2 16) chain A residue 80 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI2 17) chain A residue 88 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI2 18) chain A residue 91 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI2 19) chain A residue 65 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2); alternate => ECO:0007744|PubMed:25218447, ECO:0007744|PubMed:25755297, ECO:0007744|PubMed:25772364, ECO:0007744|PubMed:28112733 source Swiss-Prot : SWS_FT_FI3 20) chain A residue 72-81 type prosite sequence CLHTLCSGCL description ZF_RING_1 Zinc finger RING-type signature. ClHtLCsgCL source prosite : PS00518

Display surface Download Links