eF-site ID 2m2v_2-A
PDB Code 2m2v
Model 2
Chain A

click to enlarge
Title African Swine Fever Virus Pol X in the ternary complex with MgdGTP and DNA
Classification TRANSFERASE
Compound Repair DNA polymerase X
Source African swine fever virus (strain Badajoz 1971 Vero-adapted) (Ba71V) (ASFV) (DPOLX_ASFB7)
Sequence A:  MLTLIQGKKIVNHLRSRLAFEYNGQLIKILSKNIVAVGSL
RREEKMLNDVDLLIIVPEKKLLKHVLPNIRIKGLSFSVKV
CGERKCVLFIEWEKKTYQLDLFTALAEEKPYAIFHFTGPV
SYLIRIRAALKKKNYKLNQYGLFKNQTLVPLKITTEKELI
KELGFTYRIPKKRL
Description (1)  Repair DNA polymerase X (E.C.2.7.7.7)


Functional site

1) chain A
residue 49
type METAL
ligand
sequence D
description Magnesium
source Swiss-Prot : SWS_FT_FI1

2) chain A
residue 51
type METAL
ligand
sequence D
description Magnesium
source Swiss-Prot : SWS_FT_FI1

3) chain A
residue 100
type METAL
ligand
sequence D
description Magnesium
source Swiss-Prot : SWS_FT_FI1


Display surface

Download
Links