eF-site ID 2lnv_7-A
PDB Code 2lnv
Model 7
Chain A

click to enlarge
Title Solution structure of GspC-HR of typeII secretion system
Classification TRANSPORT PROTEIN
Compound General secretion pathway protein C
Source Dickeya dadantii (strain 3937) (Erwinia chrysanthemi (strain 3937)) (GSPC2_DICD3)
Sequence A:  GSHMLEMAGALDASQMSNLPPSTLNLSLTGVMAGDDDSRS
IAIISKDNEQFSRGVNEEVPGYNAKIVSIRPDRVVLQYQG
RYEVLGLYSQEDSGSDGVPGAQVR
Description (1)  General secretion pathway protein C

Display surface

Download
Links