eF-site ID 2ld1_5-A
PDB Code 2ld1
Model 5
Chain A

click to enlarge
Title Structures and chemical shift assignments for the ADD domain of the ATRX protein
Classification METAL BINDING PROTEIN
Compound Transcriptional regulator ATRX
Source Homo sapiens (Human) (ATRX_HUMAN)
Sequence A:  GAMADKRGDGLHGIVSCTACGQQVNHFQKDSIYRHPSLQV
LICKNCFKYYMSDDISRDSDGMDEQCRWCAEGGNLICCDF
CHNAFCKKCILRNLGRKELSTIMDENNQWYCYICHPEPLL
DLVTACNSVFENLEQLLQQNKK
Description (1)  Transcriptional regulator ATRX (E.C.3.6.4.12)


Functional site

1) chain A
residue 171
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN A 1
source : AC1

2) chain A
residue 174
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN A 1
source : AC1

3) chain A
residue 197
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN A 1
source : AC1

4) chain A
residue 200
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN A 1
source : AC1

5) chain A
residue 220
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN A 2
source : AC2

6) chain A
residue 223
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN A 2
source : AC2

7) chain A
residue 240
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN A 2
source : AC2

8) chain A
residue 243
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN A 2
source : AC2

9) chain A
residue 232
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN A 3
source : AC3

10) chain A
residue 235
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN A 3
source : AC3

11) chain A
residue 265
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN A 3
source : AC3

12) chain A
residue 268
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN A 3
source : AC3


Display surface

Download
Links