eF-site ID 2lbm_12-A PDB Code 2lbm Model 12 Chain A click to enlarge Title Solution structure of the ADD domain of ATRX complexed with histone tail H3 1-15 K9me3 Classification METAL BINDING PROTEIN/STRUCTURAL PROTEIN Compound Transcriptional regulator ATRX Source null (2LBM) Sequence A:  GAMADKRGDGLHGIVSCTACGQQVNHFQKDSIYRHPSLQV LICKNCFKYYMSDDISRDSDGMDEQCRWCAEGGNLICCDF CHNAFCKKCILRNLGRKELSTIMDENNQWYCYICHPEPLL DLVTACNSVFENLEQLLQQNKK Description (1)  Transcriptional regulator ATRX (E.C.3.6.4.12), histone tail H3 K9me3 Functional site 1) chain A residue 171 type sequence C description BINDING SITE FOR RESIDUE ZN A 1 source : AC1 2) chain A residue 174 type sequence C description BINDING SITE FOR RESIDUE ZN A 1 source : AC1 3) chain A residue 197 type sequence C description BINDING SITE FOR RESIDUE ZN A 1 source : AC1 4) chain A residue 200 type sequence C description BINDING SITE FOR RESIDUE ZN A 1 source : AC1 5) chain A residue 220 type sequence C description BINDING SITE FOR RESIDUE ZN A 2 source : AC2 6) chain A residue 223 type sequence C description BINDING SITE FOR RESIDUE ZN A 2 source : AC2 7) chain A residue 240 type sequence C description BINDING SITE FOR RESIDUE ZN A 2 source : AC2 8) chain A residue 243 type sequence C description BINDING SITE FOR RESIDUE ZN A 2 source : AC2 9) chain A residue 232 type sequence C description BINDING SITE FOR RESIDUE ZN A 3 source : AC3 10) chain A residue 235 type sequence C description BINDING SITE FOR RESIDUE ZN A 3 source : AC3 11) chain A residue 265 type sequence C description BINDING SITE FOR RESIDUE ZN A 3 source : AC3 12) chain A residue 268 type sequence C description BINDING SITE FOR RESIDUE ZN A 3 source : AC3

Display surface Download Links