eF-site ID 2l5y_7-A PDB Code 2l5y Model 7 Chain A click to enlarge Title NMR structure of calcium-loaded STIM2 EF-SAM. Classification SIGNALING PROTEIN Compound Stromal interaction molecule 2 Source (STIM2_HUMAN) Sequence A:  GSHMASTEEDRFSLEALQTIHKQMDDDKDGGIEVEESDEF IREDMKYKDATNKHSHLHREDKHITIEDLWKRWKTSEVHN WTLEDTLQWLIEFVELPQYEKNFRDNNVKGTTLPRIAVHE PSFMISQLKISDRSHRQKLQLKALDVVLFG Description (1)  Stromal interaction molecule 2 Functional site 1) chain A residue 80 type sequence D description BINDING SITE FOR RESIDUE CA A 300 source : AC1 2) chain A residue 82 type sequence D description BINDING SITE FOR RESIDUE CA A 300 source : AC1 3) chain A residue 84 type sequence D description BINDING SITE FOR RESIDUE CA A 300 source : AC1 4) chain A residue 86 type sequence G description BINDING SITE FOR RESIDUE CA A 300 source : AC1 5) chain A residue 88 type sequence E description BINDING SITE FOR RESIDUE CA A 300 source : AC1 6) chain A residue 91 type sequence E description BINDING SITE FOR RESIDUE CA A 300 source : AC1 7) chain A residue 135 type CARBOHYD sequence N description N-linked (GlcNAc...) asparagine => ECO:0000255 source Swiss-Prot : SWS_FT_FI2 8) chain A residue 80 type BINDING sequence D description BINDING => ECO:0000305 source Swiss-Prot : SWS_FT_FI1 9) chain A residue 82 type BINDING sequence D description BINDING => ECO:0000305 source Swiss-Prot : SWS_FT_FI1 10) chain A residue 84 type BINDING sequence D description BINDING => ECO:0000305 source Swiss-Prot : SWS_FT_FI1 11) chain A residue 91 type BINDING sequence E description BINDING => ECO:0000305 source Swiss-Prot : SWS_FT_FI1

Display surface Download Links