eF-site ID 2ki0_14-A
PDB Code 2ki0
Model 14
Chain A

click to enlarge
Title NMR Structure of a de novo designed beta alpha beta
Classification DE NOVO PROTEIN
Compound DS119
Source (2KI0)
Sequence A:  GSGQVRTIWVGGTPEELKKLKEEAKKANIRVTFWGD
Description (1)  DS119

Display surface

Download
Links