eF-site ID 2kaw_17-A PDB Code 2kaw Model 17 Chain A click to enlarge Title NMR structure of the mDvl1 PDZ domain in complex with its inhibitor Classification SIGNALING PROTEIN Compound Segment polarity protein dishevelled homolog DVL-1 Source Mus musculus (Mouse) (DVL1_MOUSE) Sequence A:  NIITVTLNMERHHFLGISIVGQSNDRGDGGIYIGSIMKGG AVAADGRIEPGDMLLQVNDVNFENMSNDDAVRVLREIVSQ TGPISLTVAK Description (1)  Segment polarity protein dishevelled homolog DVL-1 Functional site 1) chain A residue 9 type sequence M description BINDING SITE FOR RESIDUE SUZ A 91 source : AC1 2) chain A residue 14 type sequence F description BINDING SITE FOR RESIDUE SUZ A 91 source : AC1 3) chain A residue 15 type sequence L description BINDING SITE FOR RESIDUE SUZ A 91 source : AC1 4) chain A residue 16 type sequence G description BINDING SITE FOR RESIDUE SUZ A 91 source : AC1 5) chain A residue 17 type sequence I description BINDING SITE FOR RESIDUE SUZ A 91 source : AC1 6) chain A residue 18 type sequence S description BINDING SITE FOR RESIDUE SUZ A 91 source : AC1 7) chain A residue 19 type sequence I description BINDING SITE FOR RESIDUE SUZ A 91 source : AC1 8) chain A residue 68 type sequence D description BINDING SITE FOR RESIDUE SUZ A 91 source : AC1 9) chain A residue 71 type sequence V description BINDING SITE FOR RESIDUE SUZ A 91 source : AC1 10) chain A residue 72 type sequence R description BINDING SITE FOR RESIDUE SUZ A 91 source : AC1 11) chain A residue 73 type sequence V description BINDING SITE FOR RESIDUE SUZ A 91 source : AC1 12) chain A residue 74 type sequence L description BINDING SITE FOR RESIDUE SUZ A 91 source : AC1 13) chain A residue 75 type sequence R description BINDING SITE FOR RESIDUE SUZ A 91 source : AC1

Display surface Download Links