eF-site ID 2ka4_6-A PDB Code 2ka4 Model 6 Chain A click to enlarge Title NMR structure of the CBP-TAZ1/STAT2-TAD complex Classification Transcription regulator Compound Crebbp protein Source (STAT2_HUMAN) Sequence A:  ATGPTADPEKRKLIQQQLVLLLHAHKCQRREQANGEVRAC SLPHCRTMKNVLNHMTHCQAGKACQVAHCASSRQIISHWK NCTRHDCPVCLPLKNASDKR Description Functional site 1) chain A residue 362 type sequence H description BINDING SITE FOR RESIDUE ZN A 440 source : AC1 2) chain A residue 366 type sequence C description BINDING SITE FOR RESIDUE ZN A 440 source : AC1 3) chain A residue 379 type sequence C description BINDING SITE FOR RESIDUE ZN A 440 source : AC1 4) chain A residue 380 type sequence S description BINDING SITE FOR RESIDUE ZN A 440 source : AC1 5) chain A residue 393 type sequence H description BINDING SITE FOR RESIDUE ZN A 441 source : AC2 6) chain A residue 394 type sequence M description BINDING SITE FOR RESIDUE ZN A 441 source : AC2 7) chain A residue 399 type sequence A description BINDING SITE FOR RESIDUE ZN A 441 source : AC2 8) chain A residue 417 type sequence H description BINDING SITE FOR RESIDUE ZN A 442 source : AC3 9) chain A residue 421 type sequence C description BINDING SITE FOR RESIDUE ZN A 442 source : AC3 10) chain A residue 423 type sequence R description BINDING SITE FOR RESIDUE ZN A 442 source : AC3 11) chain A residue 362 type BINDING sequence H description source Swiss-Prot : SWS_FT_FI2 12) chain A residue 421 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI2 13) chain A residue 426 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI2 14) chain A residue 429 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI2 15) chain A residue 366 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI2 16) chain A residue 379 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI2 17) chain A residue 384 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI2 18) chain A residue 393 type BINDING sequence H description source Swiss-Prot : SWS_FT_FI2 19) chain A residue 397 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI2 20) chain A residue 403 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI2 21) chain A residue 408 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI2 22) chain A residue 417 type BINDING sequence H description source Swiss-Prot : SWS_FT_FI2 23) chain A residue 346-432 type ZN_FING sequence DPEKRKLIQQQLVLLLHAHKCQRREQANGEVRACSLPHCR TMKNVLNHMTHCQAGKACQVAHCASSRQIISHWKNCTRHD CPVCLPL description TAZ-type 1 => ECO:0000255|PROSITE-ProRule:PRU00203 source Swiss-Prot : SWS_FT_FI1

Display surface Download Links