eF-site ID 2k17_11-AP PDB Code 2k17 Model 11 Chain A, P click to enlarge Title Solution structure of the TAF3 PHD domain in complex with a H3K4me3 peptide Classification TRANSCRIPTION Compound H3K4me3 peptide Source (2K17) Sequence A:  GSHMAMAYVIRDEWGNQIWICPGCNKPDDGSPMIGCDDCD DWYHWPCVGIMAAPPEEMQWFCPKCANKIKKDKKH P:  ARTXQTARKSTGG Description Functional site 1) chain A residue 885 type sequence C description BINDING SITE FOR RESIDUE ZN A 940 source : AC1 2) chain A residue 887 type sequence D description BINDING SITE FOR RESIDUE ZN A 940 source : AC1 3) chain A residue 888 type sequence C description BINDING SITE FOR RESIDUE ZN A 940 source : AC1 4) chain A residue 910 type sequence F description BINDING SITE FOR RESIDUE ZN A 940 source : AC1 5) chain A residue 911 type sequence C description BINDING SITE FOR RESIDUE ZN A 940 source : AC1 6) chain A residue 869 type sequence I description BINDING SITE FOR RESIDUE ZN A 941 source : AC2 7) chain A residue 870 type sequence C description BINDING SITE FOR RESIDUE ZN A 941 source : AC2 8) chain A residue 873 type sequence C description BINDING SITE FOR RESIDUE ZN A 941 source : AC2 9) chain A residue 875 type sequence K description BINDING SITE FOR RESIDUE ZN A 941 source : AC2 10) chain A residue 870-914 type prosite sequence CPGCNKPDDGSPMIGCDDCDDWYHWPCVGIMAAPPEEMQW FCPKC description ZF_PHD_1 Zinc finger PHD-type signature. CpgCnkpddgspm....................................IgCdd..Cddw.YHwpCvgimaappeemq.................................WfCpkC source prosite : PS01359 11) chain A residue 867-917 type ZN_FING sequence IWICPGCNKPDDGSPMIGCDDCDDWYHWPCVGIMAAPPEE MQWFCPKCANK description PHD-type => ECO:0000255|PROSITE-ProRule:PRU00146 source Swiss-Prot : SWS_FT_FI1

Display surface Download Links