eF-site ID 2jzw_17-AB
PDB Code 2jzw
Model 17
Chain A, B

click to enlarge
Title How the HIV-1 nucleocapsid protein binds and destabilises the (-)primer binding site during reverse transcription
Classification VIRAL PROTEIN/DNA
Compound HIV-1 nucleocapsid protein NCp7(12-55)
Source (2JZW)
Sequence A:  NVKCFNCGKEGHTARNCRAPRKKGCWKCGKEGHQMKDCTE
RQAN
B:  GTCCCTGTTCGGGC
Description (1)  HIV-1 nucleocapsid protein NCp7(12-55)/DNA Complex


Functional site

1) chain A
residue 15
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN A 56
source : AC1

2) chain A
residue 18
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN A 56
source : AC1

3) chain A
residue 23
type
ligand
sequence H
description BINDING SITE FOR RESIDUE ZN A 56
source : AC1

4) chain A
residue 36
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN A 57
source : AC2

5) chain A
residue 39
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN A 57
source : AC2

6) chain A
residue 41
type
ligand
sequence K
description BINDING SITE FOR RESIDUE ZN A 57
source : AC2

7) chain A
residue 44
type
ligand
sequence H
description BINDING SITE FOR RESIDUE ZN A 57
source : AC2

8) chain A
residue 45
type
ligand
sequence Q
description BINDING SITE FOR RESIDUE ZN A 57
source : AC2


Display surface

Download
Links